Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein

Troponin C (cardiac) protein,

Product Info Summary

SKU: PROTP63316
Size: 20 µg
Source: HEK293T

Product Name

Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein

View all Troponin C (cardiac) recombinant proteins

SKU/Catalog Number

PROTP63316

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human troponin C type 1 (slow) (TNNC1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63316)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.2 kDa

Amino Acid Sequence

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Validation Images & Assay Conditions

Gene/Protein Information For TNNC1 (Source: Uniprot.org, NCBI)

Gene Name

TNNC1

Full Name

Troponin C, slow skeletal and cardiac muscles

Weight

18.2 kDa

Superfamily

troponin C family

Alternative Names

cardiac troponin C; CMD1Z; CMH13; slow twitch skeletal/cardiac muscle troponin C; TNC; TN-C; TNNC; troponin C type 1 (slow); troponin C, slow skeletal and cardiac muscles; troponin C, slow; troponin C1, slow TNNC1 CMD1Z, CMH13, TN-C, TNC, TNNC troponin C1, slow skeletal and cardiac type troponin C, slow skeletal and cardiac muscles|cardiac troponin C|slow twitch skeletal/cardiac muscle troponin C|troponin C type 1 (slow)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNNC1, check out the TNNC1 Infographic

TNNC1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNNC1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63316
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.