Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein

Carbonic Anhydrase I/CA1 protein,

Product Info Summary

SKU: PROTP00915
Size: 20 µg
Source: HEK293T

Product Name

Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein

View all Carbonic Anhydrase I/CA1 recombinant proteins

SKU/Catalog Number

PROTP00915

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP00915)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.7 kDa

Amino Acid Sequence

MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Validation Images & Assay Conditions

Gene/Protein Information For CA1 (Source: Uniprot.org, NCBI)

Gene Name

CA1

Full Name

Carbonic anhydrase 1

Weight

28.7 kDa

Superfamily

alpha-carbonic anhydrase family

Alternative Names

CA1; CA-I; Car1; Carbonate dehydratase I; carbonic anhydrase 1; Carbonic anhydrase B; Carbonic Anhydrase I; carbonic anhydrase ICAB; carbonic dehydratase; EC 4.2.1.1 CA1 CA-I, CAB, Car1, HEL-S-11 carbonic anhydrase 1 carbonic anhydrase 1|carbonate dehydratase I|carbonic anhydrase B|carbonic anhydrase I|epididymis secretory protein Li 11|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CA1, check out the CA1 Infographic

CA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP00915

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP00915
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.