Calbindin (CALB1) (NM_004929) Human Recombinant Protein

Calbindin D-28K protein,

Product Info Summary

SKU: PROTP05937
Size: 20 µg
Source: HEK293T

Product Name

Calbindin (CALB1) (NM_004929) Human Recombinant Protein

View all Calbindin D-28K recombinant proteins

SKU/Catalog Number

PROTP05937

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human calbindin 1, 28kDa (CALB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Calbindin (CALB1) (NM_004929) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05937)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.8 kDa

Amino Acid Sequence

MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN

Validation Images & Assay Conditions

Gene/Protein Information For CALB1 (Source: Uniprot.org, NCBI)

Gene Name

CALB1

Full Name

Calbindin

Weight

29.8 kDa

Superfamily

calbindin family

Alternative Names

CAB27; CALB; calbindin 1, (28kD); calbindin 1, 28kDa; Calbindin D28; calbindin; D-28K; RTVL-H protein; Vitamin D-dependent calcium-binding protein, avian-type CALB1 CALB, D-28K calbindin 1 calbindin|RTVL-H protein|calbindin 1, (28kD)|calbindin 1, 28kDa|calbindin 27|calbindin D28|vitamin D-dependent calcium-binding protein, avian-type

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CALB1, check out the CALB1 Infographic

CALB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CALB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05937

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Calbindin (CALB1) (NM_004929) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Calbindin (CALB1) (NM_004929) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Calbindin (CALB1) (NM_004929) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05937
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.