BRF2 (NM_018310) Human Recombinant Protein

BRF2 protein,

Recombinant protein of human BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like (BRF2)

Product Info Summary

SKU: PROTQ9HAW0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

BRF2 (NM_018310) Human Recombinant Protein

View all BRF2 recombinant proteins

SKU/Catalog Number

PROTQ9HAW0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like (BRF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BRF2 (NM_018310) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HAW0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.4 kDa

Amino Acid Sequence

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

Validation Images & Assay Conditions

Gene/Protein Information For BRF2 (Source: Uniprot.org, NCBI)

Gene Name

BRF2

Full Name

Transcription factor IIIB 50 kDa subunit

Weight

46.4 kDa

Superfamily

TFIIB family

Alternative Names

B-related factor 2; BRF-2; BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like; BRFUhTFIIIB50; FLJ11052; hBRFU; TFIIIB50RNA polymerase III transcription initiation factor BRFU; transcription factor IIB- related factor, TFIIIB50; transcription factor IIIB 50 kDa subunit BRF2 BRFU, TFIIIB50 BRF2 RNA polymerase III transcription initiation factor subunit transcription factor IIIB 50 kDa subunit|B-related factor 2|BRF-2|BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit|BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like|RNA polymerase III transcription initiation factor BRFU|hBRFU|hTFIIIB50|transcription factor IIB- related factor, TFIIIB50

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BRF2, check out the BRF2 Infographic

BRF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BRF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HAW0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BRF2 (NM_018310) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BRF2 (NM_018310) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BRF2 (NM_018310) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HAW0
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.