BNIP2 (NM_004330) Human Recombinant Protein

BNIP2 protein,

Recombinant protein of human BCL2/adenovirus E1B 19kDa interacting protein 2 (BNIP2)

Product Info Summary

SKU: PROTQ12982
Size: 20 µg
Source: HEK293T

Product Name

BNIP2 (NM_004330) Human Recombinant Protein

View all BNIP2 recombinant proteins

SKU/Catalog Number

PROTQ12982

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human BCL2/adenovirus E1B 19kDa interacting protein 2 (BNIP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BNIP2 (NM_004330) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ12982)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.7 kDa

Amino Acid Sequence

MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ

Validation Images & Assay Conditions

Gene/Protein Information For BNIP2 (Source: Uniprot.org, NCBI)

Gene Name

BNIP2

Full Name

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2

Weight

48.7 kDa

Alternative Names

BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD-interacting protein 2; BNIP-2; NIP2 BNIP2 BNIP-2, NIP2 BCL2 interacting protein 2 BCL2/adenovirus E1B 19 kDa protein-interacting protein 2|BCL2/adenovirus E1B 19kDa interacting protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BNIP2, check out the BNIP2 Infographic

BNIP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BNIP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ12982

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BNIP2 (NM_004330) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BNIP2 (NM_004330) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BNIP2 (NM_004330) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ12982
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.