ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein

Cdnf protein,

Product Info Summary

SKU: PROTQ49AH0
Size: 20 µg
Source: HEK293T

Product Name

ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein

View all Cdnf recombinant proteins

SKU/Catalog Number

PROTQ49AH0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human arginine-rich, mutated in early stage tumors-like 1 (ARMETL1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ49AH0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.8 kDa

Amino Acid Sequence

MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Validation Images & Assay Conditions

Gene/Protein Information For CDNF (Source: Uniprot.org, NCBI)

Gene Name

CDNF

Full Name

Cerebral dopamine neurotrophic factor

Weight

20.8 kDa

Superfamily

ARMET family

Alternative Names

arginine-rich, mutated in early stage tumors-like 1; ARMETL1; ARMET-like protein 1; CDNF; cerebral dopamine neurotrophic factor; Conserved dopamine neurotrophic factor Cdnf|9330140G23, Arme, Armetl1|cerebral dopamine neurotrophic factor|cerebral dopamine neurotrophic factor|ARMET-like protein 1|arginine-rich, mutated in early stage tumors-like 1|conserved dopamine neurotrophic factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDNF, check out the CDNF Infographic

CDNF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDNF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ49AH0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ49AH0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.