Anti-UNC5C Antibody Picoband™

UNC5H3/UNC5C antibody

Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9841
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-UNC5C Antibody Picoband™

View all UNC5H3/UNC5C Antibodies

SKU/Catalog Number

PB9841

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-UNC5C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9841)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9841 is reactive to UNC5C in Human, Mouse, Rat

Applications

PB9841 is guaranteed for Flow Cytometry, WB Boster Guarantee

Observed Molecular Weight

115 kDa

Calculated molecular weight

103146 MW

Background of UNC5H3/UNC5C

Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For UNC5C (Source: Uniprot.org, NCBI)

Gene Name

UNC5C

Full Name

Netrin receptor UNC5C

Weight

103146 MW

Superfamily

unc-5 family

Alternative Names

netrin receptor UNC5C; Protein unc-5 homolog 3; Protein unc-5 homolog C; unc-5 homolog 3; unc-5 homolog C (C. elegans); UNC5C; UNC5H3; UNC5H3unc5 (C.elegans homolog) c UNC5C UNC5H3 unc-5 netrin receptor C netrin receptor UNC5C|protein unc-5 homolog 3|protein unc-5 homolog C|unc-5 homolog 3|unc-5 homolog C|unc5 (C.elegans homolog) c

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on UNC5C, check out the UNC5C Infographic

UNC5C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UNC5C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9841

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-UNC5C Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-UNC5C Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-UNC5C Antibody Picoband™

Question

Will anti-UNC5C antibody PB9841 work for WB with lung?

G. Zhao

Verified customer

Asked: 2019-11-21

Answer

According to the expression profile of lung, UNC5C is highly expressed in lung. So, it is likely that anti-UNC5C antibody PB9841 will work for WB with lung.

Boster Scientific Support

Answered: 2019-11-21

Question

Please see the WB image, lot number and protocol we used for lung using anti-UNC5C antibody PB9841. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-17

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-17

Question

Does PB9841 anti-UNC5C antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-12-25

Answer

As indicated on the product datasheet, PB9841 anti-UNC5C antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-12-25

Question

I was wanting to use your anti-UNC5C antibody for WB for mouse lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung identification?

Verified Customer

Verified customer

Asked: 2017-06-14

Answer

It shows on the product datasheet, PB9841 anti-UNC5C antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-14

Question

We are currently using anti-UNC5C antibody PB9841 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

C. Krishna

Verified customer

Asked: 2015-12-01

Answer

The anti-UNC5C antibody (PB9841) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-12-01

Question

Is this PB9841 anti-UNC5C antibody reactive to the isotypes of UNC5C?

W. Jones

Verified customer

Asked: 2014-02-19

Answer

The immunogen of PB9841 anti-UNC5C antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-02-19

Question

Will anti-UNC5C antibody PB9841 work on goat WB with brain?

D. Jones

Verified customer

Asked: 2013-04-01

Answer

Our lab technicians have not validated anti-UNC5C antibody PB9841 on goat. You can run a BLAST between goat and the immunogen sequence of anti-UNC5C antibody PB9841 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-04-01

Order DetailsPrice
PB9841

100μg

$370
PB9841-10ug

10μg sample (liquid)

$99
PB9841-Biotin

100 μg Biotin conjugated

$570
PB9841-Cy3

100 μg Cy3 conjugated

$570
PB9841-Dylight488

100 μg Dylight488 conjugated

$570
PB9841-Dylight550

100 μg Dylight550 conjugated

$570
PB9841-Dylight594

100 μg Dylight594 conjugated

$570
PB9841-FITC

100 μg FITC conjugated

$570
PB9841-HRP

100 μg HRP conjugated

$570
PB9841-APC

100 μg APC conjugated

$670
PB9841-PE

100 μg PE conjugated

$670
PB9841-iFluor647

100 μg iFluor647 conjugated

$670
PB9841-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9841
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.