Product Info Summary
SKU: | PB9841 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-UNC5C Antibody Picoband™
View all UNC5H3/UNC5C Antibodies
SKU/Catalog Number
PB9841
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-UNC5C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9841)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9841 is reactive to UNC5C in Human, Mouse, Rat
Applications
PB9841 is guaranteed for Flow Cytometry, WB Boster Guarantee
Observed Molecular Weight
115 kDa
Calculated molecular weight
103146 MW
Background of UNC5H3/UNC5C
Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Human
Validation Images & Assay Conditions
![pb9841 1 WB anti unc5c unc5h3 picoband antibody pb9841 1 WB anti unc5c unc5h3 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9841-1-WB-anti-unc5c-unc5h3-picoband-antibody.jpg)
Click image to see more details
Figure 1. Western blot analysis of UNC5C using anti-UNC5C antibody (PB9841).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Brain Tissue Lysate at 50ug,
Lane 2: Mouse Brain Tissue Lysate at 50ug,
Lane 3: HELA Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-UNC5C antigen affinity purified polyclonal antibody (Catalog # PB9841) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for UNC5C at approximately 115 kDa. The expected band size for UNC5C is at 115 kDa.
![pb9841 unc5c primary antibodies fcm testing 2 pb9841 unc5c primary antibodies fcm testing 2](https://www.bosterbio.com/media/catalog/product/p/b/pb9841-unc5c-primary-antibodies-fcm-testing-2.jpg)
Click image to see more details
Figure 2. Flow Cytometry analysis of SH-SY5Y cells using anti-UNC5C antibody (PB9841).
Overlay histogram showing SH-SY5Y cells stained with PB9841 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-UNC5C Antibody (PB9841, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For UNC5C (Source: Uniprot.org, NCBI)
Gene Name
UNC5C
Full Name
Netrin receptor UNC5C
Weight
103146 MW
Superfamily
unc-5 family
Alternative Names
netrin receptor UNC5C; Protein unc-5 homolog 3; Protein unc-5 homolog C; unc-5 homolog 3; unc-5 homolog C (C. elegans); UNC5C; UNC5H3; UNC5H3unc5 (C.elegans homolog) c UNC5C UNC5H3 unc-5 netrin receptor C netrin receptor UNC5C|protein unc-5 homolog 3|protein unc-5 homolog C|unc-5 homolog 3|unc-5 homolog C|unc5 (C.elegans homolog) c
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on UNC5C, check out the UNC5C Infographic
![UNC5C infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for UNC5C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-UNC5C Antibody Picoband™ (PB9841)
Hello CJ!
No publications found for PB9841
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-UNC5C Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-UNC5C Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-UNC5C Antibody Picoband™
Question
Will anti-UNC5C antibody PB9841 work for WB with lung?
G. Zhao
Verified customer
Asked: 2019-11-21
Answer
According to the expression profile of lung, UNC5C is highly expressed in lung. So, it is likely that anti-UNC5C antibody PB9841 will work for WB with lung.
Boster Scientific Support
Answered: 2019-11-21
Question
Please see the WB image, lot number and protocol we used for lung using anti-UNC5C antibody PB9841. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-17
Question
Does PB9841 anti-UNC5C antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-12-25
Answer
As indicated on the product datasheet, PB9841 anti-UNC5C antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-12-25
Question
I was wanting to use your anti-UNC5C antibody for WB for mouse lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung identification?
Verified Customer
Verified customer
Asked: 2017-06-14
Answer
It shows on the product datasheet, PB9841 anti-UNC5C antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-06-14
Question
We are currently using anti-UNC5C antibody PB9841 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?
C. Krishna
Verified customer
Asked: 2015-12-01
Answer
The anti-UNC5C antibody (PB9841) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2015-12-01
Question
Is this PB9841 anti-UNC5C antibody reactive to the isotypes of UNC5C?
W. Jones
Verified customer
Asked: 2014-02-19
Answer
The immunogen of PB9841 anti-UNC5C antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-02-19
Question
Will anti-UNC5C antibody PB9841 work on goat WB with brain?
D. Jones
Verified customer
Asked: 2013-04-01
Answer
Our lab technicians have not validated anti-UNC5C antibody PB9841 on goat. You can run a BLAST between goat and the immunogen sequence of anti-UNC5C antibody PB9841 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-04-01