Click image to see more details
Product Info Summary
| SKU: | A01096-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TSLP Antibody Picoband®
SKU/Catalog Number
A01096-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TSLP Antibody Picoband® catalog # A01096-1. Tested in WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TSLP Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01096-1)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse TSLP, which shares 76.2% amino acid (aa) sequence identity with rat TSLP.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01096-1 is reactive to Tslp in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
18 kDa
Calculated molecular weight
16.152kDa
Background of Tslp
Thymic stromal lymphopoietin, also called TSLP is a protein belonging to the cytokine family. This gene is mapped to 5q22.1. It encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c (+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01096-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: mouse liver tissue, mouse kidney tissue, mouse testis tissue, rat heart tissue, rat liver tissue, rat kidney tissue, rat testis tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TSLP using anti-TSLP antibody (A01096-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse liver tissue lysates,
Lane 2: mouse kidney tissue lysates,
Lane 3: mouse testis tissue lysates,
Lane 4: rat heart tissue lysates,
Lane 5: rat liver tissue lysates,
Lane 6: rat kidney tissue lysates,
Lane 7: rat testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TSLP antigen affinity purified polyclonal antibody (Catalog # A01096-1) at 0.5 ug/mL overnight at 4 then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TSLP at approximately 18KD. The expected band size for TSLP is at 18KD.
Protein Target Info & Infographic
Gene/Protein Information For Tslp (Source: Uniprot.org, NCBI)
Gene Name
Tslp
Full Name
Thymic stromal lymphopoietin
Weight
16.152kDa
Alternative Names
Thymic stromal lymphopoietin; Thymic stroma-derived lymphopoietin; Tslp; Tslp|thymic stromal lymphopoietin|thymic stromal lymphopoietin|thymic stroma-derived lymphopoietin
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Tslp, check out the Tslp Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Tslp: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TSLP Antibody Picoband® (A01096-1)
Hello CJ!
No publications found for A01096-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TSLP Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-TSLP Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-TSLP Antibody Picoband®
Question
Our lab were content with the WB result of your anti-TSLP antibody. However we have seen positive staining in lung testis secreted. using this antibody. Is that expected? Could you tell me where is TSLP supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-04-20
Answer
According to literature, lung testis does express TSLP. Generally TSLP expresses in secreted. Regarding which tissues have TSLP expression, here are a few articles citing expression in various tissues:
Brain, Lung, and Testis, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2020-04-20
Question
Do you have a BSA free version of anti-TSLP antibody A01096-1 available?
Verified Customer
Verified customer
Asked: 2020-03-10
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-TSLP antibody A01096-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-10
Question
We are currently using anti-TSLP antibody A01096-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on monkey tissues as well?
T. Parker
Verified customer
Asked: 2020-02-20
Answer
The anti-TSLP antibody (A01096-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-20
Question
Will anti-TSLP antibody A01096-1 work on horse WB with brain?
Verified Customer
Verified customer
Asked: 2019-11-13
Answer
Our lab technicians have not tested anti-TSLP antibody A01096-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-TSLP antibody A01096-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-11-13
Question
Will A01096-1 anti-TSLP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
M. Li
Verified customer
Asked: 2019-11-01
Answer
As indicated on the product datasheet, A01096-1 anti-TSLP antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-11-01
Question
I was wanting to use your anti-TSLP antibody for WB for rat epithelial cell of pancreas on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat epithelial cell of pancreas identification?
S. Li
Verified customer
Asked: 2019-07-03
Answer
It shows on the product datasheet, A01096-1 anti-TSLP antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat epithelial cell of pancreas in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-07-03
Question
Is this A01096-1 anti-TSLP antibody reactive to the isotypes of TSLP?
Verified Customer
Verified customer
Asked: 2018-03-23
Answer
The immunogen of A01096-1 anti-TSLP antibody is A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-03-23
Question
Is a blocking peptide available for product anti-TSLP antibody (A01096-1)?
Verified Customer
Verified customer
Asked: 2018-03-13
Answer
We do provide the blocking peptide for product anti-TSLP antibody (A01096-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-03-13
Question
I see that the anti-TSLP antibody A01096-1 works with WB, what is the protocol used to produce the result images on the product page?
R. Li
Verified customer
Asked: 2018-02-14
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-02-14
Question
Would anti-TSLP antibody A01096-1 work for WB with epithelial cell of pancreas?
V. Rodriguez
Verified customer
Asked: 2017-09-06
Answer
According to the expression profile of epithelial cell of pancreas, TSLP is highly expressed in epithelial cell of pancreas. So, it is likely that anti-TSLP antibody A01096-1 will work for WB with epithelial cell of pancreas.
Boster Scientific Support
Answered: 2017-09-06
Question
Here is the WB image, lot number and protocol we used for epithelial cell of pancreas using anti-TSLP antibody A01096-1. Please let me know if you require anything else.
C. Anderson
Verified customer
Asked: 2016-06-14
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-06-14
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for epithelial cell of pancreas using anti-TSLP antibody A01096-1. Let me know if you need anything else.
O. Wu
Verified customer
Asked: 2016-06-09
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-06-09
Question
We have observed staining in rat lung testis. Do you have any suggestions? Is anti-TSLP antibody supposed to stain lung testis positively?
V. Thomas
Verified customer
Asked: 2014-07-21
Answer
Based on literature lung testis does express TSLP. Based on Uniprot.org, TSLP is expressed in epithelial cell of pancreas, brain, lung testis, among other tissues. Regarding which tissues have TSLP expression, here are a few articles citing expression in various tissues:
Brain, Lung, and Testis, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2014-07-21
Question
I have a question about product A01096-1, anti-TSLP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
K. Jones
Verified customer
Asked: 2013-01-22
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01096-1 anti-TSLP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-01-22
Question
We want to test anti-TSLP antibody A01096-1 on rat epithelial cell of pancreas for research purposes, then I may be interested in using anti-TSLP antibody A01096-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
E. Gonzalez
Verified customer
Asked: 2013-01-11
Answer
The products we sell, including anti-TSLP antibody A01096-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2013-01-11
