Product Info Summary
SKU: | PB10099 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Synapsin I/SYN1 Antibody Picoband®
View all Synapsin I Antibodies
SKU/Catalog Number
PB10099
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Synapsin I/SYN1 Antibody Picoband® catalog # PB10099. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Synapsin I/SYN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10099)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10099 is reactive to SYN1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
78 kDa
Calculated molecular weight
74111 MW
Background of Synapsin I
Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10099 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: rat brain tissue, mouse brain tissue, SHG-44 whole cell
IHC: human glioma tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 2. IHC analysis of Synapsin I using anti-Synapsin I antibody (PB10099).
Synapsin I was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Synapsin I Antibody (PB10099) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 1. Western blot analysis of Synapsin I using anti-Synapsin I antibody (PB10099).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates,
Lane 3: SHG-44 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Synapsin I antigen affinity purified polyclonal antibody (Catalog # PB10099) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Synapsin I at approximately 78 kDa. The expected band size for Synapsin I is at 74 kDa.
Protein Target Info & Infographic
Gene/Protein Information For SYN1 (Source: Uniprot.org, NCBI)
Gene Name
SYN1
Full Name
Synapsin-1
Weight
74111 MW
Superfamily
synapsin family
Alternative Names
Synapsin-1;Brain protein 4.1;Synapsin I;SYN1; SYN1 EPILX, MRX50a, SYN1b, SYNI, SYN1 synapsin I synapsin-1|brain protein 4.1|synapsin Ib
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SYN1, check out the SYN1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SYN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Synapsin I/SYN1 Antibody Picoband® (PB10099)
Hello CJ!
PB10099 has been cited in 10 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Rho Kinase Inhibitor Y‐27632 Down‐Regulates Norepinephrine Synthesis and Release in PC12 Cells
Effects of spontaneous recurrent seizures on cognitive function via modulation of SNAREs expression
XQ-1H promotes cerebral angiogenesis via activating PI3K/Akt/GSK3β/β-catenin/VEGF signal in mice exposed to cerebral ischemic injury
Endogenous Subventricular Zone Neural Progenitors Contribute to the Formation and Hyperexcitability of Experimental Model of Focal Microgyria
Fei Y,Zhao B,Zhu J,Fang W,Li Y.XQ-1H promotes cerebral angiogenesis via activating PI3K/Akt/GSK3β/β-catenin/VEGF signal in mice exposed to cerebral ischemic injury.Life Sci.2021 Feb 16:119234.doi:10.1016/j.lfs.2021.119234.Epub ahead of print.PMID:33607158
Species: Human,Mouse
PB10099 usage in article: APP:WB, SAMPLE:BRAIN CORTEX, DILUTION:NA
Qi, Y., Zhang, F., Song, G. et al. Cholinergic neuronal differentiation of bone marrow mesenchymal stem cells in rhesus monkeys. Sci. China Life Sci. 53, 573–580 (2010). https://doi.org/10.1007/s11427-010-0009-4
Species: rhesus monkeys
PB10099 usage in article: APP:IF, SAMPLE:cells, DILUTION:Ready to use
Neurotoxicity induced by zinc oxide nanoparticles: age-related differences and interaction
Chen Y, Wei G, Nie H, Lin Y, Tian H, Liu Y, Yu X, Cheng S, Yan R, Wang Q, Liu Dh, Deng W, Lai Y, Zhou Jh, Zhang Sx, Lin Ww, Chen Df. Brain Res. 2014 Mar 13;1552:41-54. Doi: 10.1016/J.Brainres.2014.01.005. Epub 2014 Jan 20. ??-Asarone Prevents Auto...
Huang J, Zhu C, Zhang P, Zhu Q, Liu Y, Zhu Z, Wang M, Li W, Yang G, Dong N, Liu J, Chen L, Zhang Y, Yang R, Deng L, Fan J, Wang X, Liu J, Ma B, Fu Q, Wu K. Sci Rep. 2013;3:1114. Doi: 10.1038/Srep01114. Epub 2013 Jan 23. S100+ Cells: A New Neuro-Im...
Jin F, Li L, Shi M, Li Z, Zhou J, Chen L. Behav Brain Res. 2013 Jun 1;246:116-24. Doi: 10.1016/J.Bbr.2013.02.029. Epub 2013 Mar 15. The Longitudinal Study Of Rat Hippocampus Influenced By Stress: Early Adverse Experience Enhances Hippocampal Vulne...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Synapsin I/SYN1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Synapsin I/SYN1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Synapsin I/SYN1 Antibody Picoband®
Question
Is a blocking peptide available for product anti-Synapsin I/SYN1 antibody (PB10099)?
Verified Customer
Verified customer
Asked: 2020-01-10
Answer
We do provide the blocking peptide for product anti-Synapsin I/SYN1 antibody (PB10099). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-10
Question
Please see the WB image, lot number and protocol we used for brain using anti-Synapsin I/SYN1 antibody PB10099. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-08
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-08
Question
Does PB10099 anti-Synapsin I/SYN1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-19
Answer
It shows on the product datasheet, PB10099 anti-Synapsin I/SYN1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-19
Question
My team were content with the WB result of your anti-Synapsin I/SYN1 antibody. However we have observed positive staining in brain cortex synapse. golgi apparatus using this antibody. Is that expected? Could you tell me where is SYN1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-12-02
Answer
From literature, brain cortex does express SYN1. Generally SYN1 expresses in cell junction, synapse. golgi apparatus. Regarding which tissues have SYN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 2110562, 15772651
Brain cortex, Pubmed ID: 15822905
Boster Scientific Support
Answered: 2019-12-02
Question
I see that the anti-Synapsin I/SYN1 antibody PB10099 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-10-17
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-10-17
Question
We purchased anti-Synapsin I/SYN1 antibody for WB on anterior cingulate cortex last year. I am using human, and We intend to use the antibody for IHC next. I am interested in examining anterior cingulate cortex as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2019-09-04
Answer
I looked at the website and datasheets of our anti-Synapsin I/SYN1 antibody and it seems that PB10099 has been validated on human in both WB and IHC. Thus PB10099 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-09-04
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Synapsin I/SYN1 antibody PB10099. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-27
Question
We are currently using anti-Synapsin I/SYN1 antibody PB10099 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-12
Answer
The anti-Synapsin I/SYN1 antibody (PB10099) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-12
Question
My question regarding product PB10099, anti-Synapsin I/SYN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-05-30
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10099 anti-Synapsin I/SYN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-30
Question
We have seen staining in human brain. Any tips? Is anti-Synapsin I/SYN1 antibody supposed to stain brain positively?
Verified Customer
Verified customer
Asked: 2018-08-28
Answer
From literature brain does express SYN1. From Uniprot.org, SYN1 is expressed in anterior cingulate cortex, brain, brain cortex, among other tissues. Regarding which tissues have SYN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 2110562, 15772651
Brain cortex, Pubmed ID: 15822905
Boster Scientific Support
Answered: 2018-08-28
Question
I was wanting to use your anti-Synapsin I/SYN1 antibody for IHC for mouse brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain identification?
Verified Customer
Verified customer
Asked: 2018-03-14
Answer
As indicated on the product datasheet, PB10099 anti-Synapsin I/SYN1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-03-14
Question
Is this PB10099 anti-Synapsin I/SYN1 antibody reactive to the isotypes of SYN1?
R. Banerjee
Verified customer
Asked: 2017-10-26
Answer
The immunogen of PB10099 anti-Synapsin I/SYN1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-10-26
Question
I am interested in to test anti-Synapsin I/SYN1 antibody PB10099 on mouse brain for research purposes, then I may be interested in using anti-Synapsin I/SYN1 antibody PB10099 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
C. Edwards
Verified customer
Asked: 2017-07-05
Answer
The products we sell, including anti-Synapsin I/SYN1 antibody PB10099, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-07-05
Question
Will anti-Synapsin I/SYN1 antibody PB10099 work for IHC with brain?
B. Baker
Verified customer
Asked: 2017-04-14
Answer
According to the expression profile of brain, SYN1 is highly expressed in brain. So, it is likely that anti-Synapsin I/SYN1 antibody PB10099 will work for IHC with brain.
Boster Scientific Support
Answered: 2017-04-14
Question
Do you have a BSA free version of anti-Synapsin I/SYN1 antibody PB10099 available?
Z. Li
Verified customer
Asked: 2016-08-30
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Synapsin I/SYN1 antibody PB10099 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2016-08-30
Question
I would like using your anti-Synapsin I/SYN1 antibody for neurotransmitter secretion studies. Has this antibody been tested with western blotting on mouse brain? We would like to see some validation images before ordering.
C. Parker
Verified customer
Asked: 2013-11-08
Answer
Thank you for your inquiry. This PB10099 anti-Synapsin I/SYN1 antibody is validated on mouse brain. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2013-11-08