Click image to see more details
Product Info Summary
| SKU: | PB9395 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SMAD1 Antibody Picoband®
SKU/Catalog Number
PB9395
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SMAD1 Antibody Picoband® catalog # PB9395. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SMAD1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9395)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1, different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9395 is reactive to SMAD1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
52 kDa
Calculated molecular weight
52260 MW
Background of SMAD1
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9395 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: Rat Cardiac Muscle Tissue, Mouse Cardiac Muscle Tissue, Rat Skeletal Muscle Tissue, Mouse Skeletal Muscle Tissue, 293T Whole Cell, MCF-7 Whole Cell, HELA Whole Cell
Validation Images & Assay Conditions
Click image to see more details
Anti-SMAD1 Picoband antibody, PB9395, Western blotting
All lanes: Anti SMAD1 (PB9395) at 0.5ug/ml
Lane 1: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 2: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 3: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 4: Mouse Skeletal Muscle Tissue Lysate at 50ug
Lane 5: 293T Whole Cell Lysate at 40ug
Lane 6: MCF-7 Whole Cell Lysate at 40ug
Lane 7: HELA Whole Cell Lysate at 40ug
Predicted bind size: 52KD
Observed bind size: 52KD
Protein Target Info & Infographic
Gene/Protein Information For SMAD1 (Source: Uniprot.org, NCBI)
Gene Name
SMAD1
Full Name
Mothers against decapentaplegic homolog 1
Weight
52260 MW
Superfamily
dwarfin/SMAD family
Alternative Names
Mothers against decapentaplegic homolog 1;MAD homolog 1;Mothers against DPP homolog 1;JV4-1;Mad-related protein 1;SMAD family member 1;SMAD 1;Smad1;hSMAD1;Transforming growth factor-beta-signaling protein 1;BSP-1;SMAD1;BSP1, MADH1, MADR1; SMAD1 BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1 SMAD family member 1 mothers against decapentaplegic homolog 1|MAD, mothers against decapentaplegic homolog 1|Mad-related protein 1|SMAD, mothers against DPP homolog 1|TGF-beta signaling protein 1|mothers against DPP homolog 1|transforming growth factor-beta signaling protein 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SMAD1, check out the SMAD1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SMAD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SMAD1 Antibody Picoband® (PB9395)
Hello CJ!
PB9395 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Inhibition of TMEM16A by Natural Product Silibinin: Potential Lead Compounds for Treatment of Lung Adenocarcinoma
Shi K, Jiang J, Ma T, Xie J, Duan L, Chen R, Song P, Yu Z, Liu C, Zhu Q, Zheng J. Int J Clin Exp Med. 2014 Sep 15;7(9):2645-50. Ecollection 2014. Dexamethasone Attenuates Bleomycin-Induced Lung Fibrosis In Mice Through Tgf-??, Smad3 And Jak-Stat P...
Tao Y, Hu L, Li S, Liu Q, Wu X, Li D, Fu P, Wei D, Luo Z. Transplant Proc. 2011 Jun;43(5):1985-8. Doi: 10.1016/J.Transproceed.2011.01.160. Tranilast Prevents The Progression Of Chronic Cyclosporine Nephrotoxicity Through Regulation Of Transforming...
Chen Wh, Kong Xy, Wan R, Xiao Cs, Li L, Wang Zy, Lin N, Wang Hm. Chin J Integr Med. 2012 May;18(5):378-84. Doi: 10.1007/S11655-012-1086-Y. Epub 2012 May 2. Effects Of Huogu I Formula (I) On Correlated Factors Of Bone Regeneration In Chickens With ...
Tang Y, Li Y, Yu H, Gao C, Liu L, Chen S, Xing M, Liu L, Yao P. J Nutr Biochem. 2014 Jun;25(6):675-82. Doi: 10.1016/J.Jnutbio.2014.02.009. Epub 2014 Mar 19. Quercetin Prevents Ethanol-Induced Iron Overload By Regulating Hepcidin Through The Bmp6/S...
Xu T, Ni Mm, Huang C, Meng Xm, He Yh, Zhang L, Li J. Inflammation. 2015 Oct;38(5):1794-804. Doi: 10.1007/S10753-015-0157-6. Nlrc5 Mediates Il-6 And Il-1?? Secretion In Lx-2 Cells And Modulated By The Nf-??b/Smad3 Pathway.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SMAD1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SMAD1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-SMAD1 Antibody Picoband®
Question
Is this PB9395 anti-SMAD1 antibody reactive to the isotypes of SMAD1?
Verified Customer
Verified customer
Asked: 2020-03-04
Answer
The immunogen of PB9395 anti-SMAD1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-04
Question
We have seen staining in mouse visceral pleura. What should we do? Is anti-SMAD1 antibody supposed to stain visceral pleura positively?
Verified Customer
Verified customer
Asked: 2020-03-03
Answer
According to literature visceral pleura does express SMAD1. According to Uniprot.org, SMAD1 is expressed in visceral pleura, kidney, mammary carcinoma, placenta, uterus, ovarian carcinoma, among other tissues. Regarding which tissues have SMAD1 expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 8637600
Mammary carcinoma, Pubmed ID: 8663601
Ovarian carcinoma, Pubmed ID: 9136927
Placenta, Pubmed ID: 8774881, 15489334
Uterus, Pubmed ID: 14702039, 17974005
Boster Scientific Support
Answered: 2020-03-03
Question
I was wanting to use your anti-SMAD1 antibody for WB for human placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human placenta identification?
Verified Customer
Verified customer
Asked: 2019-10-25
Answer
It shows on the product datasheet, PB9395 anti-SMAD1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-10-25
Question
See attached the WB image, lot number and protocol we used for placenta using anti-SMAD1 antibody PB9395. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-04
Question
Does PB9395 anti-SMAD1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-07-18
Answer
It shows on the product datasheet, PB9395 anti-SMAD1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-18
Question
We were content with the WB result of your anti-SMAD1 antibody. However we have seen positive staining in uterus cytoplasm. using this antibody. Is that expected? Could you tell me where is SMAD1 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-07-11
Answer
According to literature, uterus does express SMAD1. Generally SMAD1 expresses in cytoplasm. Regarding which tissues have SMAD1 expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 8637600
Mammary carcinoma, Pubmed ID: 8663601
Ovarian carcinoma, Pubmed ID: 9136927
Placenta, Pubmed ID: 8774881, 15489334
Uterus, Pubmed ID: 14702039, 17974005
Boster Scientific Support
Answered: 2019-07-11
Question
We are currently using anti-SMAD1 antibody PB9395 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-07-09
Answer
The anti-SMAD1 antibody (PB9395) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-09
Question
My question regarding product PB9395, anti-SMAD1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
P. Huang
Verified customer
Asked: 2019-04-11
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9395 anti-SMAD1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-04-11
Question
I see that the anti-SMAD1 antibody PB9395 works with WB, what is the protocol used to produce the result images on the product page?
L. Patel
Verified customer
Asked: 2019-02-01
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-02-01
Question
I am interested in to test anti-SMAD1 antibody PB9395 on human placenta for research purposes, then I may be interested in using anti-SMAD1 antibody PB9395 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-12-24
Answer
The products we sell, including anti-SMAD1 antibody PB9395, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-12-24
Question
Would anti-SMAD1 antibody PB9395 work for WB with placenta?
J. Bhatt
Verified customer
Asked: 2018-10-16
Answer
According to the expression profile of placenta, SMAD1 is highly expressed in placenta. So, it is likely that anti-SMAD1 antibody PB9395 will work for WB with placenta.
Boster Scientific Support
Answered: 2018-10-16
Question
Is there a BSA free version of anti-SMAD1 antibody PB9395 available?
Verified Customer
Verified customer
Asked: 2018-05-23
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SMAD1 antibody PB9395 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-05-23
Question
Is a blocking peptide available for product anti-SMAD1 antibody (PB9395)?
E. Krishna
Verified customer
Asked: 2017-05-12
Answer
We do provide the blocking peptide for product anti-SMAD1 antibody (PB9395). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-05-12
Question
I am interested in using your anti-SMAD1 antibody for signal transduction studies. Has this antibody been tested with western blotting on cardiac muscle tissue? We would like to see some validation images before ordering.
A. Evans
Verified customer
Asked: 2017-05-12
Answer
Thanks for your inquiry. This PB9395 anti-SMAD1 antibody is tested on rat skeletal muscle tissue, cardiac muscle tissue, tissue lysate, mouse skeletal muscle tissue, 293t whole cell lysate, hela whole cell lysate. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-05-12
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-SMAD1 antibody PB9395. Let me know if you need anything else.
J. Jones
Verified customer
Asked: 2017-01-26
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-01-26
