Product Info Summary
SKU: | PB9745 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, IHC-F, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SLC10A1 Antibody Picoband®
SKU/Catalog Number
PB9745
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SLC10A1 Antibody Picoband® catalog # PB9745. Tested in Flow Cytometry, IF, IHC, IHC-F, WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SLC10A1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9745)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1, different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9745 is reactive to Slc10a1 in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
50 kDa
Calculated molecular weight
39413 MW
Background of SLC10A1
Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9745 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: rat liver tissue, mouse liver tissue
IHC: mouse liver tissue, rat liver tissue
IHC-F: mouse liver tissue
IF: mouse liver tissue
FCM: RAW264.7 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 6. Flow Cytometry analysis of RAW264.7 cells using anti-SLC10A1 antibody (PB9745).
Overlay histogram showing RAW264.7 cells stained with PB9745 (Blue line). The cells were fixed with 4% paraformaldehyde and blocked with 10% normal goat serum. And then incubated with rabbit anti-SLC10A1 Antibody (PB9745,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 1. Western blot analysis of SLC10A1 using anti-SLC10A1 antibody (PB9745).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: mouse liver tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC10A1 antigen affinity purified polyclonal antibody (Catalog # PB9745) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SLC10A1 at approximately 50 kDa. The expected band size for SLC10A1 is at 38 kDa.
Click image to see more details
Figure 2. IHC analysis of SLC10A1 using anti-SLC10A1 antibody (PB9745).
SLC10A1 was detected in a paraffin-embedded section of mouse liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-SLC10A1 Antibody (PB9745) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SLC10A1 using anti-SLC10A1 antibody (PB9745).
SLC10A1 was detected in a paraffin-embedded section of rat liver tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-SLC10A1 Antibody (PB9745) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SLC10A1 using anti-SLC10A1 antibody (PB9745).
SLC10A1 was detected in frozen section of mouse liver tissue . The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SLC10A1 Antibody (PB9745) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of SLC10A1 using anti- SLC10A1 antibody (PB9745).
SLC10A1 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti- SLC10A1 Antibody (PB9745) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1037) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For Slc10a1 (Source: Uniprot.org, NCBI)
Gene Name
Slc10a1
Full Name
Sodium/bile acid cotransporter
Weight
39413 MW
Superfamily
bile acid:sodium symporter (BASS) (TC 2.A.28) family
Alternative Names
Sodium/bile acid cotransporter;Na (+)/bile acid cotransporter;Na (+)/taurocholate transport protein;Sodium/taurocholate cotransporting polypeptide;Solute carrier family 10 member 1;Slc10a1;Ntcp; SLC10A1 NTCP solute carrier family 10 member 1 sodium/bile acid cotransporter|Na(+)/bile acid cotransporter|Na(+)/taurocholate transport protein|Na/taurocholate cotransporting polypeptide|cell growth-inhibiting gene 29 protein|growth-inhibiting protein 29|sodium/taurocholate cotransporter|sodium/taurocholate cotransporting polypeptide|solute carrier family 10 (sodium/bile acid cotransporter family), member 1|solute carrier family 10 (sodium/bile acid cotransporter), member 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Slc10a1, check out the Slc10a1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Slc10a1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SLC10A1 Antibody Picoband® (PB9745)
Hello CJ!
PB9745 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Biomimetic niches reveal the minimal cues to trigger apical lumen formation in single hepatocytes
Species: Rat
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SLC10A1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SLC10A1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
2 Customer Q&As for Anti-SLC10A1 Antibody Picoband®
Question
I am inquiring regarding PB9745. I was kindly wondering if any validation studies have been performed for the specificity of this antibody for human NTCP. Is it known whether or not this antibody potentially cross-reacts with human proteins other than NTCP?
Verified customer
Asked: 2022-08-05
Answer
Thank you for your inquiry. Our lab hasn't experimentally validated cross-reactivity with human proteins other than NTCP. The immunogen sequence for PB9745 is EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK.
Boster Scientific Support
Answered: 2022-08-05
Question
We are currently using anti-SLC10A1 antibody PB9745 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2019-04-03
Answer
The anti-SLC10A1 antibody (PB9745) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-04-03