Anti-Rad51 Antibody Picoband®

RAD51 antibody

Boster Bio Anti-Rad51 Antibody Picoband® catalog # A00088. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00088
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Rad51 Antibody Picoband®

View all RAD51 Antibodies

SKU/Catalog Number

A00088

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Rad51 Antibody Picoband® catalog # A00088. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Rad51 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00088)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Rad51, which shares 97.1% amino acid (aa) sequence identity with both mouse and rat Rad51.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00088 is reactive to RAD51 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

39 kDa

Calculated molecular weight

68996 MW

Background of RAD51

DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00088 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

WB: human Hela whole cell, human A431 whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, human A549 whole cell, human Caco-2 whole cell, rat testis tissue, mouse testis tissue, mouse thymus tissue
IHC: human placenta tissue, human testis tissue, mouse brain tissue, rat brain tissue
ICC/IF: U20S cell
FCM: SiHa cell

Validation Images & Assay Conditions

Gene/Protein Information For RAD51 (Source: Uniprot.org, NCBI)

Gene Name

RAD51

Full Name

DNA repair protein RAD51 homolog 1

Weight

68996 MW

Superfamily

RecA family

Alternative Names

DNA repair protein RAD51 homolog 1; HsRAD51; hRAD51; RAD51 homolog A; RAD51; RAD51A; RECA RAD51 BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2A, RECA, RAD51 RAD51 recombinase DNA repair protein RAD51 homolog 1|BRCA1/BRCA2-containing complex, subunit 5|RAD51 homolog A|RecA, E. coli, homolog of|RecA-like protein|recombination protein A

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on RAD51, check out the RAD51 Infographic

RAD51 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAD51: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00088

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Rad51 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Rad51 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Rad51 Antibody Picoband®

Question

Can you help my question with product A00088, anti-Rad51 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

S. Li

Verified customer

Asked: 2020-04-22

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00088 anti-Rad51 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-22

Question

I am interested in to test anti-Rad51 antibody A00088 on human placenta for research purposes, then I may be interested in using anti-Rad51 antibody A00088 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-20

Answer

The products we sell, including anti-Rad51 antibody A00088, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-20

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-01-22

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-22

Question

Is this A00088 anti-Rad51 antibody reactive to the isotypes of RAD51?

Verified Customer

Verified customer

Asked: 2020-01-08

Answer

The immunogen of A00088 anti-Rad51 antibody is A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-08

Question

Our team were satisfied with the WB result of your anti-Rad51 antibody. However we have seen positive staining in brain nucleus using this antibody. Is that expected? Could you tell me where is RAD51 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-10

Answer

Based on literature, brain does express RAD51. Generally RAD51 expresses in nucleus. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919

Boster Scientific Support

Answered: 2019-12-10

Question

Is a blocking peptide available for product anti-Rad51 antibody (A00088)?

Verified Customer

Verified customer

Asked: 2019-12-02

Answer

We do provide the blocking peptide for product anti-Rad51 antibody (A00088). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-02

Question

Will anti-Rad51 antibody A00088 work for WB with placenta?

Verified Customer

Verified customer

Asked: 2019-09-13

Answer

According to the expression profile of placenta, RAD51 is highly expressed in placenta. So, it is likely that anti-Rad51 antibody A00088 will work for WB with placenta.

Boster Scientific Support

Answered: 2019-09-13

Question

We are currently using anti-Rad51 antibody A00088 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-06

Answer

The anti-Rad51 antibody (A00088) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-06

Question

I was wanting to use your anti-Rad51 antibody for WB for human placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human placenta identification?

Verified Customer

Verified customer

Asked: 2019-06-21

Answer

You can see on the product datasheet, A00088 anti-Rad51 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-06-21

Question

Would A00088 anti-Rad51 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

N. Singh

Verified customer

Asked: 2018-07-27

Answer

It shows on the product datasheet, A00088 anti-Rad51 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-07-27

Question

I have attached the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-06-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-06-29

Question

Is there a BSA free version of anti-Rad51 antibody A00088 available?

Verified Customer

Verified customer

Asked: 2018-01-18

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Rad51 antibody A00088 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-01-18

Question

I see that the anti-Rad51 antibody A00088 works with WB, what is the protocol used to produce the result images on the product page?

J. Carter

Verified customer

Asked: 2017-11-23

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-11-23

Question

We bought anti-Rad51 antibody for IHC on brain in the past. I am using rat, and We intend to use the antibody for WB next. I would like examining brain as well as embryo in our next experiment. Do you have any suggestion on which antibody would work the best for WB?

C. Wu

Verified customer

Asked: 2017-03-29

Answer

I looked at the website and datasheets of our anti-Rad51 antibody and it appears that A00088 has been validated on rat in both IHC and WB. Thus A00088 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2017-03-29

Question

We have been able to see staining in mouse brain. Any tips? Is anti-Rad51 antibody supposed to stain brain positively?

Z. Rodriguez

Verified customer

Asked: 2014-03-28

Answer

From literature brain does express RAD51. From Uniprot.org, RAD51 is expressed in embryo, testis, brain, placenta, among other tissues. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919

Boster Scientific Support

Answered: 2014-03-28

Question

We want using your anti-Rad51 antibody for chromosome organization involved in meiotic cell cycle studies. Has this antibody been tested with western blotting on 293t whole cell lysate? We would like to see some validation images before ordering.

A. Johnson

Verified customer

Asked: 2014-01-21

Answer

We appreciate your inquiry. This A00088 anti-Rad51 antibody is tested on human testis tissue, hela whole cell lysate, a431 whole cell lysate, 293t whole cell lysate, k562 whole cell lysate, jurkat whole cell lysate, a549 whole cell lysate, rat testis tissue, mouse thymus tissue, placenta tissue, brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2014-01-21

Order DetailsPrice
A00088

100μg

$370
A00088-10ug

10μg sample (liquid)

$99
A00088-Biotin

100 μg Biotin conjugated

$570
A00088-Cy3

100 μg Cy3 conjugated

$570
A00088-Dylight488

100 μg Dylight488 conjugated

$570
A00088-Dylight550

100 μg Dylight550 conjugated

$570
A00088-Dylight594

100 μg Dylight594 conjugated

$570
A00088-FITC

100 μg FITC conjugated

$570
A00088-HRP

100 μg HRP conjugated

$570
A00088-APC

100 μg APC conjugated

$670
A00088-PE

100 μg PE conjugated

$670
A00088-iFluor647

100 μg iFluor647 conjugated

$670
A00088-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00088
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.