Product Info Summary
SKU: | A00088 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Rad51 Antibody Picoband®
SKU/Catalog Number
A00088
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Rad51 Antibody Picoband® catalog # A00088. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Rad51 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00088)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Rad51, which shares 97.1% amino acid (aa) sequence identity with both mouse and rat Rad51.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00088 is reactive to RAD51 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
39 kDa
Calculated molecular weight
68996 MW
Background of RAD51
DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00088 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human Hela whole cell, human A431 whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, human A549 whole cell, human Caco-2 whole cell, rat testis tissue, mouse testis tissue, mouse thymus tissue
IHC: human placenta tissue, human testis tissue, mouse brain tissue, rat brain tissue
ICC/IF: U20S cell
FCM: SiHa cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Rad51 using anti-Rad51 antibody (A00088).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,
Lane 2: human A431 whole cell lysate,
Lane 3: human 293T whole cell lysate,
Lane 4: human K562 whole cell lysate,
Lane 5: human Jurkat whole cell lysate,
Lane 6: human A549 whole cell lysate,
Lane 7: human Caco-2 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Rad51 antigen affinity purified polyclonal antibody (Catalog # A00088) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Rad51 at approximately 39KD. The expected band size for Rad51 is at 36KD.
Click image to see more details
Figure 2. Western blot analysis of Rad51 using anti-Rad51 antibody (A00088).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: mouse testis tissue lysates,
Lane 3: mouse thymus tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Rad51 antigen affinity purified polyclonal antibody (Catalog # A00088) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Rad51 at approximately 39KD. The expected band size for Rad51 is at 36KD.
Click image to see more details
Figure 3. IHC analysis of Rad51 using anti-Rad51 antibody (A00088).
Rad51 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Rad51 Antibody (A00088) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of Rad51 using anti-Rad51 antibody (A00088).
Rad51 was detected in paraffin-embedded section of human testis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Rad51 Antibody (A00088) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of Rad51 using anti-Rad51 antibody (A00088).
Rad51 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Rad51 Antibody (A00088) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of Rad51 using anti-Rad51 antibody (A00088).
Rad51 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Rad51 Antibody (A00088) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IF analysis of Rad51 using anti-Rad51 antibody (A00088).
Rad51 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-Rad51 Antibody (A00088) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 8. Flow Cytometry analysis of SiHa cells using anti-Rad51 antibody (A00088).
Overlay histogram showing SiHa cells stained with A00088 (Blue line).To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Rad51 Antibody (A00088,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For RAD51 (Source: Uniprot.org, NCBI)
Gene Name
RAD51
Full Name
DNA repair protein RAD51 homolog 1
Weight
68996 MW
Superfamily
RecA family
Alternative Names
DNA repair protein RAD51 homolog 1; HsRAD51; hRAD51; RAD51 homolog A; RAD51; RAD51A; RECA RAD51 BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2A, RECA, RAD51 RAD51 recombinase DNA repair protein RAD51 homolog 1|BRCA1/BRCA2-containing complex, subunit 5|RAD51 homolog A|RecA, E. coli, homolog of|RecA-like protein|recombination protein A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on RAD51, check out the RAD51 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RAD51: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Rad51 Antibody Picoband® (A00088)
Hello CJ!
No publications found for A00088
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Rad51 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Rad51 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Rad51 Antibody Picoband®
Question
Can you help my question with product A00088, anti-Rad51 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
S. Li
Verified customer
Asked: 2020-04-22
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00088 anti-Rad51 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-22
Question
I am interested in to test anti-Rad51 antibody A00088 on human placenta for research purposes, then I may be interested in using anti-Rad51 antibody A00088 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-04-20
Answer
The products we sell, including anti-Rad51 antibody A00088, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-04-20
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-01-22
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-22
Question
Is this A00088 anti-Rad51 antibody reactive to the isotypes of RAD51?
Verified Customer
Verified customer
Asked: 2020-01-08
Answer
The immunogen of A00088 anti-Rad51 antibody is A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-08
Question
Our team were satisfied with the WB result of your anti-Rad51 antibody. However we have seen positive staining in brain nucleus using this antibody. Is that expected? Could you tell me where is RAD51 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-12-10
Answer
Based on literature, brain does express RAD51. Generally RAD51 expresses in nucleus. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919
Boster Scientific Support
Answered: 2019-12-10
Question
Is a blocking peptide available for product anti-Rad51 antibody (A00088)?
Verified Customer
Verified customer
Asked: 2019-12-02
Answer
We do provide the blocking peptide for product anti-Rad51 antibody (A00088). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-02
Question
Will anti-Rad51 antibody A00088 work for WB with placenta?
Verified Customer
Verified customer
Asked: 2019-09-13
Answer
According to the expression profile of placenta, RAD51 is highly expressed in placenta. So, it is likely that anti-Rad51 antibody A00088 will work for WB with placenta.
Boster Scientific Support
Answered: 2019-09-13
Question
We are currently using anti-Rad51 antibody A00088 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-06
Answer
The anti-Rad51 antibody (A00088) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-06
Question
I was wanting to use your anti-Rad51 antibody for WB for human placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human placenta identification?
Verified Customer
Verified customer
Asked: 2019-06-21
Answer
You can see on the product datasheet, A00088 anti-Rad51 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-21
Question
Would A00088 anti-Rad51 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
N. Singh
Verified customer
Asked: 2018-07-27
Answer
It shows on the product datasheet, A00088 anti-Rad51 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-07-27
Question
I have attached the WB image, lot number and protocol we used for placenta using anti-Rad51 antibody A00088. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-06-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-29
Question
Is there a BSA free version of anti-Rad51 antibody A00088 available?
Verified Customer
Verified customer
Asked: 2018-01-18
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Rad51 antibody A00088 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-01-18
Question
I see that the anti-Rad51 antibody A00088 works with WB, what is the protocol used to produce the result images on the product page?
J. Carter
Verified customer
Asked: 2017-11-23
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-11-23
Question
We bought anti-Rad51 antibody for IHC on brain in the past. I am using rat, and We intend to use the antibody for WB next. I would like examining brain as well as embryo in our next experiment. Do you have any suggestion on which antibody would work the best for WB?
C. Wu
Verified customer
Asked: 2017-03-29
Answer
I looked at the website and datasheets of our anti-Rad51 antibody and it appears that A00088 has been validated on rat in both IHC and WB. Thus A00088 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2017-03-29
Question
We have been able to see staining in mouse brain. Any tips? Is anti-Rad51 antibody supposed to stain brain positively?
Z. Rodriguez
Verified customer
Asked: 2014-03-28
Answer
From literature brain does express RAD51. From Uniprot.org, RAD51 is expressed in embryo, testis, brain, placenta, among other tissues. Regarding which tissues have RAD51 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 14702039
Placenta, Pubmed ID: 15489334
Testis, Pubmed ID: 8479919
Boster Scientific Support
Answered: 2014-03-28
Question
We want using your anti-Rad51 antibody for chromosome organization involved in meiotic cell cycle studies. Has this antibody been tested with western blotting on 293t whole cell lysate? We would like to see some validation images before ordering.
A. Johnson
Verified customer
Asked: 2014-01-21
Answer
We appreciate your inquiry. This A00088 anti-Rad51 antibody is tested on human testis tissue, hela whole cell lysate, a431 whole cell lysate, 293t whole cell lysate, k562 whole cell lysate, jurkat whole cell lysate, a549 whole cell lysate, rat testis tissue, mouse thymus tissue, placenta tissue, brain tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2014-01-21