Product Info Summary
SKU: | A05756-1 |
---|---|
Size: | 100μl |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PP2A-A beta PPP2R1B Antibody
SKU/Catalog Number
A05756-1
Size
100μl
Form
Liquid
Description
Boster Bio Anti-PP2A-A beta PPP2R1B Antibody catalog # A05756-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PP2A-A beta PPP2R1B Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05756-1)
Host
Rabbit
Contents
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Clonality
Polyclonal
Isotype
IgG
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP1 Synthetic peptide FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
A05756-1 is reactive to PPP2R1B in Human, Mouse, Rat
Applications
A05756-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
66214 MW
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
WB, 1:500-1:2000
Validation Images & Assay Conditions
Click image to see more details
Western Blot (WB) analysis of specific cells using PP2A-Abeta Polyclonal antibody.
Protein Target Info & Infographic
Gene/Protein Information For PPP2R1B (Source: Uniprot.org, NCBI)
Gene Name
PPP2R1B
Full Name
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
Weight
66214 MW
Superfamily
phosphatase 2A regulatory subunit A family
Alternative Names
MGC26454; PP2A subunit A isoform PR65-beta; PP2A subunit A isoform R1-beta; PP2A, subunit A, PR65-beta isoform; PP2A, subunit A, R1-beta isoform; PP2A-Abeta; PR65B; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform; protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform; protein phosphatase 2, regulatory subunit A, beta; protein phosphatase 2, structural/regulatory subunit A, beta; serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A betaisoform PPP2R1B PP2A-Abeta, PR65B protein phosphatase 2 scaffold subunit Abeta serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform|protein phosphatase 2, regulatory subunit A, beta|protein phosphatase 2, structural/regulatory subunit A, beta
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PPP2R1B, check out the PPP2R1B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PPP2R1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PP2A-A beta PPP2R1B Antibody (A05756-1)
Hello CJ!
No publications found for A05756-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PP2A-A beta PPP2R1B Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PP2A-A beta PPP2R1B Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-PP2A-A beta PPP2R1B Antibody
Question
We are currently using anti-PP2A-A beta antibody A05756-1 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-15
Answer
The anti-PP2A-A beta antibody (A05756-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-15
Question
Is there a BSA free version of anti-PP2A-A beta antibody A05756-1 available?
Verified Customer
Verified customer
Asked: 2019-07-22
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PP2A-A beta antibody A05756-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-07-22
Question
I am interested in to test anti-PP2A-A beta antibody A05756-1 on rat testis thalamus for research purposes, then I may be interested in using anti-PP2A-A beta antibody A05756-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-22
Answer
The products we sell, including anti-PP2A-A beta antibody A05756-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-22
Question
My question regarding product A05756-1, anti-PP2A-A beta antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-02-20
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05756-1 anti-PP2A-A beta antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-02-20
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis thalamus using anti-PP2A-A beta antibody A05756-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-02-07
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-02-07
Question
Will anti-PP2A-A beta antibody A05756-1 work for WB with testis thalamus?
Verified Customer
Verified customer
Asked: 2017-12-28
Answer
According to the expression profile of testis thalamus, PPP2R1B is highly expressed in testis thalamus. So, it is likely that anti-PP2A-A beta antibody A05756-1 will work for WB with testis thalamus.
Boster Scientific Support
Answered: 2017-12-28