Click image to see more details
Product Info Summary
| SKU: | PB10013 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Perilipin 3/PLIN3 Antibody Picoband®
View all Perilipin-3/TIP47 Antibodies
SKU/Catalog Number
PB10013
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Perilipin 3/PLIN3 Antibody Picoband® catalog # PB10013. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Perilipin 3/PLIN3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10013)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3, different from the related mouse sequence by fourteen amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB10013 is reactive to PLIN3 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
47 kDa
Calculated molecular weight
47075 MW
Background of Perilipin-3/TIP47
Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10013 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: rat liver tissue, mouse kidney tissue, HELA whole cell
IHC: human lung cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 2. IHC analysis of Perilipin 3 using anti-Perilipin 3 antibody (PB10013).
Perilipin 3 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Perilipin 3 Antibody (PB10013) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 1. Western blot analysis of Perilipin 3 using anti-Perilipin 3 antibody (PB10013).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: mouse kidney tissue lysates,
Lane 3: HELA whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Perilipin 3 antigen affinity purified polyclonal antibody (Catalog # PB10013) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Perilipin 3 at approximately 47 kDa. The expected band size for Perilipin 3 is at 47 kDa.
Protein Target Info & Infographic
Gene/Protein Information For PLIN3 (Source: Uniprot.org, NCBI)
Gene Name
PLIN3
Full Name
Perilipin-3
Weight
47075 MW
Superfamily
perilipin family
Alternative Names
Perilipin-3;47 kDa mannose 6-phosphate receptor-binding protein;47 kDa MPR-binding protein;Cargo selection protein TIP47;Mannose-6-phosphate receptor-binding protein 1;Placental protein 17;PP17;PLIN3;M6PRBP1, TIP47; PLIN3 M6PRBP1, PP17, TIP47 perilipin 3 perilipin-3|47 kDa MPR-binding protein|cargo selection protein TIP47|mannose-6-phosphate receptor-binding protein 1|placental protein 17|tail-interacting protein, 47 kD|testicular tissue protein Li 114
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PLIN3, check out the PLIN3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PLIN3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Perilipin 3/PLIN3 Antibody Picoband® (PB10013)
Hello CJ!
No publications found for PB10013
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Perilipin 3/PLIN3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Perilipin 3/PLIN3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Perilipin 3/PLIN3 Antibody Picoband®
Question
Is this PB10013 anti-Perilipin 3/PLIN3 antibody reactive to the isotypes of PLIN3?
Verified Customer
Verified customer
Asked: 2019-11-25
Answer
The immunogen of PB10013 anti-Perilipin 3/PLIN3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-25
Question
Would anti-Perilipin 3/PLIN3 antibody PB10013 work for WB with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
According to the expression profile of cervix carcinoma erythroleukemia, PLIN3 is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-Perilipin 3/PLIN3 antibody PB10013 will work for WB with cervix carcinoma erythroleukemia.
Boster Scientific Support
Answered: 2019-09-11
Question
Would PB10013 anti-Perilipin 3/PLIN3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-08-28
Answer
As indicated on the product datasheet, PB10013 anti-Perilipin 3/PLIN3 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-08-28
Question
See below the WB image, lot number and protocol we used for cervix carcinoma erythroleukemia using anti-Perilipin 3/PLIN3 antibody PB10013. Please let me know if you require anything else.
R. Carter
Verified customer
Asked: 2019-01-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-11
Question
Does anti-Perilipin 3/PLIN3 antibody PB10013 work on monkey WB with mouth mucosa?
Verified Customer
Verified customer
Asked: 2017-11-22
Answer
Our lab technicians have not tested anti-Perilipin 3/PLIN3 antibody PB10013 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-Perilipin 3/PLIN3 antibody PB10013 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey mouth mucosa in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-11-22
Question
We are currently using anti-Perilipin 3/PLIN3 antibody PB10013 for human tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2017-10-23
Answer
The anti-Perilipin 3/PLIN3 antibody (PB10013) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-10-23
Question
I see that the anti-Perilipin 3/PLIN3 antibody PB10013 works with WB, what is the protocol used to produce the result images on the product page?
M. Bhatt
Verified customer
Asked: 2014-03-13
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-03-13
