Click image to see more details
Product Info Summary
| SKU: | PB9734 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Pax2 Antibody Picoband®
SKU/Catalog Number
PB9734
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Pax2 Antibody Picoband® catalog # PB9734. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Pax2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9734)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9734 is reactive to PAX2 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
45 kDa
Calculated molecular weight
44706 MW
Background of PAX2
Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9734 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Rat, Human
Positive Control
WB: Rat Brain Tissue, Rat Lung Tissue
IHC: mouse lymphaden tissue, rat lymphaden tissue, human tonsil tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Pax2 using anti-Pax2 antibody (PB9734).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 ug of sample under reducing conditions.
Lane 1: Rat Brain Tissue Lysate,
Lane 2: Rat Lung Tissue Lysate.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Pax2 antigen affinity purified polyclonal antibody (Catalog # PB9734) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Pax2 at approximately 45 kDa. The expected band size for Pax2 is at 45 kDa.
Click image to see more details
Figure 2. IHC analysis of Pax2 using anti-Pax2 antibody (PB9734).
Pax2 was detected in a paraffin-embedded section of mouse lymphaden tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Pax2 Antibody (PB9734) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Pax2 using anti-Pax2 antibody (PB9734).
Pax2 was detected in a paraffin-embedded section of rat lymphaden tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Pax2 Antibody (PB9734) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of Pax2 using anti-Pax2 antibody (PB9734).
Pax2 was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Pax2 Antibody (PB9734) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For PAX2 (Source: Uniprot.org, NCBI)
Gene Name
PAX2
Full Name
Paired box protein Pax-2
Weight
44706 MW
Alternative Names
Paired box protein Pax-2;PAX2; PAX2 FSGS7, PAPRS paired box 2 paired box protein Pax-2|paired box homeotic gene 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PAX2, check out the PAX2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PAX2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Pax2 Antibody Picoband® (PB9734)
Hello CJ!
PB9734 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Increased repetitive self-grooming occurs in Pax2 mutant mice generated using CRISPR/Cas9
Matrine suppresses the migration and invasion of NSCLC cells by inhibiting PAX2-induced epithelial-mesenchymal transition
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Pax2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Pax2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Pax2 Antibody Picoband®
Question
We have observed staining in mouse kidney cortex. Any tips? Is anti-Pax2 antibody supposed to stain kidney cortex positively?
Verified Customer
Verified customer
Asked: 2020-03-27
Answer
According to literature kidney cortex does express PAX2. According to Uniprot.org, PAX2 is expressed in cortex of kidney, kidney, kidney cortex, leukemic t-cell, among other tissues. Regarding which tissues have PAX2 expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 1378753
Kidney cortex, Pubmed ID: 7819127, 8661132
Leukemic T-cell, Pubmed ID: 19690332
Boster Scientific Support
Answered: 2020-03-27
Question
Do you have a BSA free version of anti-Pax2 antibody PB9734 available?
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Pax2 antibody PB9734 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-18
Question
My lab would like to test anti-Pax2 antibody PB9734 on rat kidney cortex for research purposes, then I may be interested in using anti-Pax2 antibody PB9734 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
K. Li
Verified customer
Asked: 2020-02-11
Answer
The products we sell, including anti-Pax2 antibody PB9734, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-11
Question
We ordered your anti-Pax2 antibody for WB on kidney cortex last year. I am using human, and We are going to use the antibody for IHC next. We need examining kidney cortex as well as kidney in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2020-01-13
Answer
I looked at the website and datasheets of our anti-Pax2 antibody and it appears that PB9734 has been validated on human in both WB and IHC. Thus PB9734 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-01-13
Question
We are currently using anti-Pax2 antibody PB9734 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-28
Answer
The anti-Pax2 antibody (PB9734) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-28
Question
I see that the anti-Pax2 antibody PB9734 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-09-25
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-25
Question
We are interested in using your anti-Pax2 antibody for axonogenesis studies. Has this antibody been tested with western blotting on lung tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-20
Answer
We appreciate your inquiry. This PB9734 anti-Pax2 antibody is validated on rat lymphaden tissue, brain tissue, tissue lysate, lung tissue, mouse lymphaden tissue, human tonsil tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-20
Question
Is this PB9734 anti-Pax2 antibody reactive to the isotypes of PAX2?
Verified Customer
Verified customer
Asked: 2018-12-27
Answer
The immunogen of PB9734 anti-Pax2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-12-27
Question
I have attached the WB image, lot number and protocol we used for kidney cortex using anti-Pax2 antibody PB9734. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-09-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-09-17
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for kidney cortex using anti-Pax2 antibody PB9734. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-07-30
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-07-30
Question
I was wanting to use your anti-Pax2 antibody for IHC for rat kidney cortex on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat kidney cortex identification?
Verified Customer
Verified customer
Asked: 2018-04-24
Answer
You can see on the product datasheet, PB9734 anti-Pax2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat kidney cortex in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-04-24
Question
Does anti-Pax2 antibody PB9734 work for IHC with kidney cortex?
Verified Customer
Verified customer
Asked: 2017-10-11
Answer
According to the expression profile of kidney cortex, PAX2 is highly expressed in kidney cortex. So, it is likely that anti-Pax2 antibody PB9734 will work for IHC with kidney cortex.
Boster Scientific Support
Answered: 2017-10-11
Question
My team were happy with the WB result of your anti-Pax2 antibody. However we have seen positive staining in kidney nucleus. using this antibody. Is that expected? Could you tell me where is PAX2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-06-28
Answer
According to literature, kidney does express PAX2. Generally PAX2 expresses in nucleus. Regarding which tissues have PAX2 expression, here are a few articles citing expression in various tissues:
Kidney, Pubmed ID: 1378753
Kidney cortex, Pubmed ID: 7819127, 8661132
Leukemic T-cell, Pubmed ID: 19690332
Boster Scientific Support
Answered: 2017-06-28
Question
Will PB9734 anti-Pax2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
E. Carter
Verified customer
Asked: 2015-06-16
Answer
You can see on the product datasheet, PB9734 anti-Pax2 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2015-06-16
Question
Is a blocking peptide available for product anti-Pax2 antibody (PB9734)?
M. Mangal
Verified customer
Asked: 2014-01-31
Answer
We do provide the blocking peptide for product anti-Pax2 antibody (PB9734). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2014-01-31
Question
My question regarding product PB9734, anti-Pax2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
R. Miller
Verified customer
Asked: 2013-02-07
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9734 anti-Pax2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-02-07
