Product Info Summary
SKU: | M03531 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Mouse |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-NFIA Antibody Picoband® (monoclonal, 16H11)
SKU/Catalog Number
M03531
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-NFIA Antibody Picoband® (monoclonal, 16H11) catalog # M03531. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-NFIA Antibody Picoband® (monoclonal, 16H11) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M03531)
Host
Mouse
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Monoclonal
Clone Number
16H11
Isotype
Mouse IgG2b
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA, different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
M03531 is reactive to NFIA in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
Observed Molecular Weight
62 kDa
Calculated molecular weight
55.944kDa
Background of NFIA
Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
M03531 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
WB: human Hela whole cell,, human HEK293 whole cell
IHC: human intestinal cancer tissue, human intestinal cancer tissue, human tonsil tissue
ICC/IF: A431 cell
FCM: U20S cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NFIA using anti-NFIA antibody (M03531).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates;
Lane 2: human HEK293 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-NFIA antigen affinity purified monoclonal antibody (Catalog # M03531) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1001) with Tanon 5200 system. A specific band was detected for NFIA at approximately 62KD. The expected band size for NFIA is at 62KD.
Click image to see more details
Figure 2. IHC analysis of NFIA using anti-NFIA antibody (M03531).
NFIA was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml mouse anti-NFIA Antibody (M03531) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1021) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of NFIA using anti-NFIA antibody (M03531).
NFIA was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml mouse anti-NFIA Antibody (M03531) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1021) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of NFIA using anti-NFIA antibody (M03531).
NFIA was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml mouse anti-NFIA Antibody (M03531) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1021) with DAB as the chromogen.
Click image to see more details
Figure 5. IF analysis of NFIA using anti-NFIA antibody (M03531).
NFIA was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL mouse anti-NFIA Antibody (M03531) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of U20S cells using anti- NFIA antibody (M03531).
Overlay histogram showing U20S cells stained with M03531 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIA Antibody (M03531, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For NFIA (Source: Uniprot.org, NCBI)
Gene Name
NFIA
Full Name
Nuclear factor 1 A-type
Weight
55.944kDa
Superfamily
CTF/NF-I family
Alternative Names
Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/A; NF-I/A; NFI-A; TGGCA-binding protein; NFIA; KIAA1439 NFIA BRMUTD, CTF, NF-I/A, NF1-A, NFI-A, NFI-L nuclear factor I A nuclear factor 1 A-type|CCAAT-box-binding transcription factor|TGGCA-binding protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NFIA, check out the NFIA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NFIA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-NFIA Antibody Picoband® (monoclonal, 16H11) (M03531)
Hello CJ!
No publications found for M03531
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-NFIA Antibody Picoband® (monoclonal, 16H11)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-NFIA Antibody Picoband® (monoclonal, 16H11)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-NFIA Antibody Picoband® (monoclonal, 16H11)
Question
Would anti-NFIA antibody (monoclonal, 16H11) M03531 work for WB with brain?
Verified Customer
Verified customer
Asked: 2020-02-26
Answer
According to the expression profile of brain, NFIA is highly expressed in brain. So, it is likely that anti-NFIA antibody (monoclonal, 16H11) M03531 will work for WB with brain.
Boster Scientific Support
Answered: 2020-02-26
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-NFIA antibody (monoclonal, 16H11) M03531. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-02-14
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-14
Question
We want to test anti-NFIA antibody (monoclonal, 16H11) M03531 on human brain for research purposes, then I may be interested in using anti-NFIA antibody (monoclonal, 16H11) M03531 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-12-13
Answer
The products we sell, including anti-NFIA antibody (monoclonal, 16H11) M03531, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-12-13
Question
Would M03531 anti-NFIA antibody (monoclonal, 16H11) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-08-20
Answer
You can see on the product datasheet, M03531 anti-NFIA antibody (monoclonal, 16H11) as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-08-20
Question
Is this M03531 anti-NFIA antibody (monoclonal, 16H11) reactive to the isotypes of NFIA?
F. Moore
Verified customer
Asked: 2016-07-25
Answer
The immunogen of M03531 anti-NFIA antibody (monoclonal, 16H11) is A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-07-25
Question
Will anti-NFIA antibody (monoclonal, 16H11) M03531 work on dog IHC-P with brain?
A. Brown
Verified customer
Asked: 2015-03-16
Answer
Our lab technicians have not validated anti-NFIA antibody (monoclonal, 16H11) M03531 on dog. You can run a BLAST between dog and the immunogen sequence of anti-NFIA antibody (monoclonal, 16H11) M03531 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog brain in IHC-P, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-03-16