Anti-NFIA Antibody Picoband® (monoclonal, 16H11)

NFIA antibody

Boster Bio Anti-NFIA Antibody Picoband® (monoclonal, 16H11) catalog # M03531. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: M03531
Size: 100 μg/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-NFIA Antibody Picoband® (monoclonal, 16H11)

View all NFIA Antibodies

SKU/Catalog Number

M03531

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-NFIA Antibody Picoband® (monoclonal, 16H11) catalog # M03531. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-NFIA Antibody Picoband® (monoclonal, 16H11) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M03531)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Monoclonal

Clone Number

16H11

Isotype

Mouse IgG2b

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human NFIA, different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

M03531 is reactive to NFIA in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Observed Molecular Weight

62 kDa

Calculated molecular weight

55.944kDa

Background of NFIA

Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

M03531 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Positive Control

WB: human Hela whole cell,, human HEK293 whole cell
IHC: human intestinal cancer tissue, human intestinal cancer tissue, human tonsil tissue
ICC/IF: A431 cell
FCM: U20S cell

Validation Images & Assay Conditions

Gene/Protein Information For NFIA (Source: Uniprot.org, NCBI)

Gene Name

NFIA

Full Name

Nuclear factor 1 A-type

Weight

55.944kDa

Superfamily

CTF/NF-I family

Alternative Names

Nuclear factor 1 A-type; NF1-A; Nuclear factor 1/A; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/A; NF-I/A; NFI-A; TGGCA-binding protein; NFIA; KIAA1439 NFIA BRMUTD, CTF, NF-I/A, NF1-A, NFI-A, NFI-L nuclear factor I A nuclear factor 1 A-type|CCAAT-box-binding transcription factor|TGGCA-binding protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NFIA, check out the NFIA Infographic

NFIA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NFIA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for M03531

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-NFIA Antibody Picoband® (monoclonal, 16H11)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-NFIA Antibody Picoband® (monoclonal, 16H11)

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-NFIA Antibody Picoband® (monoclonal, 16H11)

Question

Would anti-NFIA antibody (monoclonal, 16H11) M03531 work for WB with brain?

Verified Customer

Verified customer

Asked: 2020-02-26

Answer

According to the expression profile of brain, NFIA is highly expressed in brain. So, it is likely that anti-NFIA antibody (monoclonal, 16H11) M03531 will work for WB with brain.

Boster Scientific Support

Answered: 2020-02-26

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-NFIA antibody (monoclonal, 16H11) M03531. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-02-14

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-14

Question

We want to test anti-NFIA antibody (monoclonal, 16H11) M03531 on human brain for research purposes, then I may be interested in using anti-NFIA antibody (monoclonal, 16H11) M03531 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-12-13

Answer

The products we sell, including anti-NFIA antibody (monoclonal, 16H11) M03531, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-12-13

Question

Would M03531 anti-NFIA antibody (monoclonal, 16H11) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-08-20

Answer

You can see on the product datasheet, M03531 anti-NFIA antibody (monoclonal, 16H11) as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-08-20

Question

Is this M03531 anti-NFIA antibody (monoclonal, 16H11) reactive to the isotypes of NFIA?

F. Moore

Verified customer

Asked: 2016-07-25

Answer

The immunogen of M03531 anti-NFIA antibody (monoclonal, 16H11) is A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-07-25

Question

Will anti-NFIA antibody (monoclonal, 16H11) M03531 work on dog IHC-P with brain?

A. Brown

Verified customer

Asked: 2015-03-16

Answer

Our lab technicians have not validated anti-NFIA antibody (monoclonal, 16H11) M03531 on dog. You can run a BLAST between dog and the immunogen sequence of anti-NFIA antibody (monoclonal, 16H11) M03531 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog brain in IHC-P, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-03-16

Order DetailsPrice
M03531

100μg

$370
M03531-10ug

10μg sample (liquid)

$99
M03531-Biotin

100 μg Biotin conjugated

$570
M03531-Cy3

100 μg Cy3 conjugated

$570
M03531-Dylight488

100 μg Dylight488 conjugated

$570
M03531-Dylight550

100 μg Dylight550 conjugated

$570
M03531-Dylight594

100 μg Dylight594 conjugated

$570
M03531-FITC

100 μg FITC conjugated

$570
M03531-HRP

100 μg HRP conjugated

$570
M03531-APC

100 μg APC conjugated

$670
M03531-PE

100 μg PE conjugated

$670
M03531-iFluor647

100 μg iFluor647 conjugated

$670
M03531-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
M03531
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.