Anti-IL22 Antibody Picoband™

IL-22 antibody

Boster Bio Anti-IL22 Antibody Picoband™ catalog # A00963-2. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00963-2
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-IL22 Antibody Picoband™

View all IL-22 Antibodies

SKU/Catalog Number

A00963-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IL22 Antibody Picoband™ catalog # A00963-2. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IL22 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00963-2)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IL22, which shares 85.4% and 82.9% amino acid (aa) sequence identity with mouse and rat IL22, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00963-2 is reactive to IL22 in Human, Mouse, Rat

Applications

A00963-2 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

20 kDa

Calculated molecular weight

Background of IL-22

Interleukin-22 (IL-22), also known as ILTIF, is protein that in humans is encoded by the IL22 gene. IL-22 a member of a group of cytokines called the IL-10 family or IL-10 superfamily, a class of potent mediators of cellular inflammatory responses. Using FISH, the IL22 gene is mapped to chromosome 12q15, close to the IFNG and the herpesvirus saimiri-induced AK155 genes. IL-22 can contribute to immune disease through the stimulation of inflammatory responses, S100s and defensins. It also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. In some contexts, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by the often co-expressed cytokine IL-17A.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For IL22 (Source: Uniprot.org, NCBI)

Gene Name

IL22

Full Name

Interleukin-22

Weight

Superfamily

IL-10 family

Alternative Names

Cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL22; IL-22; IL-D110; IL-TIF; ILTIFIL-10-related T-cell-derived-inducible factor; IL-TIFMGC79382; interleukin 22; interleukin-22; MGC79384; TIFa; TIFIL-23; zcyto18 IL22 IL-21, IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18 interleukin 22 interleukin-22|IL-10-related T-cell-derived inducible factor|cytokine Zcyto18

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on IL22, check out the IL22 Infographic

IL22 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL22: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00963-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-IL22 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-IL22 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-IL22 Antibody Picoband™

Question

We have observed staining in mouse blood. Any tips? Is anti-IL22 antibody supposed to stain blood positively?

K. Anderson

Verified customer

Asked: 2020-04-16

Answer

From what I have seen in literature blood does express IL22. From what I have seen in Uniprot.org, IL22 is expressed in zone of skin, blood, among other tissues. Regarding which tissues have IL22 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-04-16

Question

Would anti-IL22 antibody A00963-2 work for WB with zone of skin?

Verified Customer

Verified customer

Asked: 2020-04-01

Answer

According to the expression profile of zone of skin, IL22 is highly expressed in zone of skin. So, it is likely that anti-IL22 antibody A00963-2 will work for WB with zone of skin.

Boster Scientific Support

Answered: 2020-04-01

Question

I was wanting to use your anti-IL22 antibody for WB for rat zone of skin on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat zone of skin identification?

Verified Customer

Verified customer

Asked: 2020-02-12

Answer

You can see on the product datasheet, A00963-2 anti-IL22 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat zone of skin in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-12

Question

Is this A00963-2 anti-IL22 antibody reactive to the isotypes of IL22?

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

The immunogen of A00963-2 anti-IL22 antibody is A synthetic peptide corresponding to a sequence of human IL22 (DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-20

Question

See below the WB image, lot number and protocol we used for zone of skin using anti-IL22 antibody A00963-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-20

Question

Our lab were well pleased with the WB result of your anti-IL22 antibody. However we have been able to see positive staining in blood secreted. using this antibody. Is that expected? Could you tell me where is IL22 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

Based on literature, blood does express IL22. Generally IL22 expresses in secreted. Regarding which tissues have IL22 expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-01-01

Question

Is a blocking peptide available for product anti-IL22 antibody (A00963-2)?

Verified Customer

Verified customer

Asked: 2019-08-12

Answer

We do provide the blocking peptide for product anti-IL22 antibody (A00963-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-08-12

Question

I have a question about product A00963-2, anti-IL22 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-04-10

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00963-2 anti-IL22 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-04-10

Question

Would A00963-2 anti-IL22 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-02-22

Answer

It shows on the product datasheet, A00963-2 anti-IL22 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-02-22

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for zone of skin using anti-IL22 antibody A00963-2. Let me know if you need anything else.

B. Lewis

Verified customer

Asked: 2018-01-31

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-01-31

Question

Do you have a BSA free version of anti-IL22 antibody A00963-2 available?

Verified Customer

Verified customer

Asked: 2017-11-17

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-IL22 antibody A00963-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-11-17

Question

My question regards to test anti-IL22 antibody A00963-2 on rat zone of skin for research purposes, then I may be interested in using anti-IL22 antibody A00963-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

T. Banerjee

Verified customer

Asked: 2016-03-28

Answer

The products we sell, including anti-IL22 antibody A00963-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2016-03-28

Question

I see that the anti-IL22 antibody A00963-2 works with WB, what is the protocol used to produce the result images on the product page?

R. Zhao

Verified customer

Asked: 2013-11-20

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-11-20

Question

We are currently using anti-IL22 antibody A00963-2 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

L. Krishna

Verified customer

Asked: 2013-01-02

Answer

The anti-IL22 antibody (A00963-2) has not been tested for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-01-02

Order DetailsPrice
A00963-2

100μg

$370
A00963-2-10ug

10μg sample (liquid)

$99
A00963-2-Biotin

100 μg Biotin conjugated

$570
A00963-2-Cy3

100 μg Cy3 conjugated

$570
A00963-2-Dylight488

100 μg Dylight488 conjugated

$570
A00963-2-Dylight550

100 μg Dylight550 conjugated

$570
A00963-2-Dylight594

100 μg Dylight594 conjugated

$570
A00963-2-FITC

100 μg FITC conjugated

$570
A00963-2-HRP

100 μg HRP conjugated

$570
A00963-2-APC

100 μg APC conjugated

$670
A00963-2-PE

100 μg PE conjugated

$670
A00963-2-iFluor647

100 μg iFluor647 conjugated

$670
A00963-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00963-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.