Product Info Summary
SKU: | PB9668 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | ELISA, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-MMP9 Antibody Picoband®
SKU/Catalog Number
PB9668
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-MMP9 Antibody Picoband® catalog # PB9668. Tested in ELISA, IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-MMP9 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9668)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9, different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9668 is reactive to MMP9 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
79 kDa
Calculated molecular weight
78458 MW
Background of MMP-9
Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9668 is guaranteed for ELISA, IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human
ELISA, 0.1-0.5μg/ml, -,
Positive Control
WB: human A549 whole cell
IHC: human liver cancer tissue, human liver cancer tissue, human lymphadenoma tissue, human lymph nodes of gastric adenocarcinoma rectal cancer tissue, human colonic adenocarcinoma tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of MMP9 using anti-MMP9 antibody (PB9668).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human A549 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MMP9 antigen affinity purified polyclonal antibody (Catalog # PB9668) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for MMP9 at approximately 79 kDa. The expected band size for MMP9 is at 79 kDa.
Click image to see more details
Figure 2. IHC analysis of MMP9 using anti-MMP9 antibody (PB9668).
MMP9 was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MMP9 Antibody (PB9668) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of MMP9 using anti-MMP9 antibody (PB9668).
MMP9 was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MMP9 Antibody (PB9668) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of MMP9 using anti-MMP9 antibody (PB9668).
MMP9 was detected in a paraffin-embedded section of human lymphadenoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MMP9 Antibody (PB9668) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of MMP9 using anti-MMP9 antibody (PB9668).
MMP9 was detected in a paraffin-embedded section of human lymph nodes of gastric adenocarcinoma rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MMP9 Antibody (PB9668) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of MMP9 using anti-MMP9 antibody (PB9668).
MMP9 was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-MMP9 Antibody (PB9668) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For MMP9 (Source: Uniprot.org, NCBI)
Gene Name
MMP9
Full Name
Matrix metalloproteinase-9
Weight
78458 MW
Superfamily
peptidase M10A family
Alternative Names
Matrix metalloproteinase-9;MMP-9;3.4.24.35;92 kDa gelatinase;92 kDa type IV collagenase;Gelatinase B;GELB;67 kDa matrix metalloproteinase-9;82 kDa matrix metalloproteinase-9;MMP9;CLG4B; MMP9 CLG4B, GELB, MANDP2, MMP-9 matrix metallopeptidase 9 matrix metalloproteinase-9|macrophage gelatinase|matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|type V collagenase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on MMP9, check out the MMP9 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MMP9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-MMP9 Antibody Picoband® (PB9668)
Hello CJ!
PB9668 has been cited in 68 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Li CH,Liu M,Pan LH,Sun Y.ANP reduced Hedgehog signaling-mediated activation of matrix metalloproteinase-9 in gastric cancer cell line MGC-803.Gene.2020 Dec 15;762:145044.doi:10.1016/j.gene.2020.145044.Epub 2020 Aug 7.PMID:32777528.
Species: Human
PB9668 usage in article: APP:WB, SAMPLE:MGC-803 CELL, DILUTION:1:400
Ketamine inhibits lipopolysaccharide-induced astrocytes activation by suppressing TLR4/NF-%u0138B pathway
1-calcium phosphate-uracil, a synthesized pyrimidine derivative agent, has anti-proliferative, pro-apoptotic and anti-invasion effects on multiple tumor cell lines
MgCl2 and ZnCl2 promote human umbilical vein endothelial cell migration and invasion and stimulate epithelial-mesenchymal transition via the Wnt/?-catenin pathway
Main components of pomegranate, ellagic acid and luteolin, inhibit metastasis of ovarian cancer by down-regulating MMP2 and MMP9
Early changes in the apparent diffusion coefficient and MMP-9 expression of a cervical carcinoma U14 allograft model following irradiation
Mesenchymal stem cells overexpressing adrenomedullin improve heart function through antifibrotic action in rats experiencing heart failure
Adipose differentiation-related protein knockdown inhibits vascular smooth muscle cell proliferation and migration and attenuates neointima formation
Hydrogen sulfide reduced renal tissue fibrosis by regulating autophagy in diabetic rats
Role of transforming growth factor ?-1 in the pathogenesis of pelvic organ prolapse: A potential therapeutic target
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-MMP9 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-MMP9 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-MMP9 Antibody Picoband®
Question
Do you have a BSA free version of anti-MMP9 antibody PB9668 available?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-MMP9 antibody PB9668 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-06
Question
We have observed staining in human umbilical cord blood. Any tips? Is anti-MMP9 antibody supposed to stain umbilical cord blood positively?
Verified Customer
Verified customer
Asked: 2019-12-06
Answer
Based on literature umbilical cord blood does express MMP9. Based on Uniprot.org, MMP9 is expressed in tibia, umbilical cord blood, b-cell, neutrophil, fibrosarcoma, blood, monocytic leukemia, among other tissues. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-12-06
Question
My boss were well pleased with the WB result of your anti-MMP9 antibody. However we have been able to see positive staining in umbilical cord blood extracellular using this antibody. Is that expected? Could you tell me where is MMP9 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-12-06
Answer
From what I have seen in literature, umbilical cord blood does express MMP9. Generally MMP9 expresses in secreted, extracellular space, extracellular. Regarding which tissues have MMP9 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Blood, Pubmed ID: 1480034, 1281792
Fibrosarcoma, Pubmed ID: 1400481, 7669817
Monocytic leukemia, Pubmed ID: 20800577
Neutrophil, Pubmed ID: 1645657, 1464361, 1653055
Umbilical cord blood, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-12-06
Question
We bought anti-MMP9 antibody for WB on tibia a few months ago. I am using human, and We are going to use the antibody for ELISA next. I was wanting to use examining tibia as well as monocytic leukemia in our next experiment. Could give a recommendation on which antibody would work the best for ELISA?
Verified Customer
Verified customer
Asked: 2019-11-25
Answer
I have checked the website and datasheets of our anti-MMP9 antibody and it seems that PB9668 has been tested on human in both WB and ELISA. Thus PB9668 should work for your application. Our Boster satisfaction guarantee will cover this product for ELISA in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for ELISA detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-11-25
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for blood using anti-MMP9 antibody PB9668. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-08
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-08
Question
Please see the WB image, lot number and protocol we used for blood using anti-MMP9 antibody PB9668. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-28
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-28
Question
Is this PB9668 anti-MMP9 antibody reactive to the isotypes of MMP9?
Verified Customer
Verified customer
Asked: 2019-08-23
Answer
The immunogen of PB9668 anti-MMP9 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-23
Question
We are interested in to test anti-MMP9 antibody PB9668 on human blood for research purposes, then I may be interested in using anti-MMP9 antibody PB9668 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-25
Answer
The products we sell, including anti-MMP9 antibody PB9668, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-25
Question
I was wanting to use your anti-MMP9 antibody for WB for human blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human blood identification?
Verified Customer
Verified customer
Asked: 2019-07-09
Answer
As indicated on the product datasheet, PB9668 anti-MMP9 antibody has been validated for ELISA, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human blood in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-07-09
Question
Is a blocking peptide available for product anti-MMP9 antibody (PB9668)?
Verified Customer
Verified customer
Asked: 2019-07-02
Answer
We do provide the blocking peptide for product anti-MMP9 antibody (PB9668). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-07-02
Question
Would PB9668 anti-MMP9 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-04-25
Answer
It shows on the product datasheet, PB9668 anti-MMP9 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-04-25
Question
We are currently using anti-MMP9 antibody PB9668 for human tissue, and we are satisfied with the ELISA results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?
R. Edwards
Verified customer
Asked: 2019-03-06
Answer
The anti-MMP9 antibody (PB9668) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-03-06
Question
My question regarding product PB9668, anti-MMP9 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2017-09-06
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9668 anti-MMP9 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-09-06
Question
My question regards using your anti-MMP9 antibody for positive regulation of release of cytochrome c from mitochondria studies. Has this antibody been tested with western blotting on sw620 whole cell lysate? We would like to see some validation images before ordering.
M. Lewis
Verified customer
Asked: 2017-08-02
Answer
I appreciate your inquiry. This PB9668 anti-MMP9 antibody is validated on sw620 whole cell lysate. It is guaranteed to work for ELISA, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-08-02
Question
Will anti-MMP9 antibody PB9668 work for WB with blood?
C. Williams
Verified customer
Asked: 2016-08-15
Answer
According to the expression profile of blood, MMP9 is highly expressed in blood. So, it is likely that anti-MMP9 antibody PB9668 will work for WB with blood.
Boster Scientific Support
Answered: 2016-08-15
Question
I see that the anti-MMP9 antibody PB9668 works with WB, what is the protocol used to produce the result images on the product page?
E. Miller
Verified customer
Asked: 2014-07-17
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-07-17