Anti-Melanoma gp100/PMEL Antibody Picoband™

PMEL17/SILV antibody

Boster Bio Anti-Melanoma gp100/PMEL Antibody Picoband™ catalog # A01262-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01262-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Melanoma gp100/PMEL Antibody Picoband™

View all PMEL17/SILV Antibodies

SKU/Catalog Number

A01262-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Melanoma gp100/PMEL Antibody Picoband™ catalog # A01262-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Melanoma gp100/PMEL Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01262-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Melanoma gp100/PMEL, which shares 71.4% and 65.7% amino acid (aa) sequence identity with mouse and rat Melanoma gp100/PMEL, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01262-1 is reactive to PMEL in Human, Mouse, Rat

Applications

A01262-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

70 kDa

Calculated molecular weight

Background of PMEL17/SILV

This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For PMEL (Source: Uniprot.org, NCBI)

Gene Name

PMEL

Full Name

Melanocyte protein PMEL

Weight

Superfamily

PMEL/NMB family

Alternative Names

D12S53EP1; gp100; ME20; ME20-M; melanocyte protein mel 17; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; melanosomal matrix protein17; PMEL17P100; premelanosome proteinME20M; SI; SIL; silver (mouse homolog) like; silver homolog (mouse); Silver locus protein homolog; silver, mouse, homolog of; SILVPmel17 PMEL D12S53E, ME20, ME20-M, ME20M, P1, P10017, SI, SIL, SILV, gp100, PMEL premelanosome protein melanocyte protein PMEL|melanocyte protein Pmel 17|melanocyte protein mel 17|melanocytes lineage-specific antigen GP100|melanoma-associated ME20 antigen|melanosomal matrix protein17|silver locus protein homolog|silver, mouse, homolog of

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PMEL, check out the PMEL Infographic

PMEL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PMEL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01262-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Melanoma gp100/PMEL Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Melanoma gp100/PMEL Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Melanoma gp100/PMEL Antibody Picoband™

Question

Would anti-Melanoma gp100/PMEL antibody A01262-1 work for WB with melanoma?

Verified Customer

Verified customer

Asked: 2020-03-18

Answer

According to the expression profile of melanoma, PMEL is highly expressed in melanoma. So, it is likely that anti-Melanoma gp100/PMEL antibody A01262-1 will work for WB with melanoma.

Boster Scientific Support

Answered: 2020-03-18

Question

Do you have a BSA free version of anti-Melanoma gp100/PMEL antibody A01262-1 available?

Verified Customer

Verified customer

Asked: 2020-02-19

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Melanoma gp100/PMEL antibody A01262-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-19

Question

Does A01262-1 anti-Melanoma gp100/PMEL antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-02-18

Answer

You can see on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-02-18

Question

We have seen staining in human pigmented layer of retina. Any tips? Is anti-Melanoma gp100/PMEL antibody supposed to stain pigmented layer of retina positively?

Verified Customer

Verified customer

Asked: 2020-01-31

Answer

Based on literature pigmented layer of retina does express PMEL. Based on Uniprot.org, PMEL is expressed in pigmented layer of retina, placenta spleen, placenta, melanoma, among other tissues. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-01-31

Question

We are currently using anti-Melanoma gp100/PMEL antibody A01262-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-26

Answer

The anti-Melanoma gp100/PMEL antibody (A01262-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-26

Question

Is a blocking peptide available for product anti-Melanoma gp100/PMEL antibody (A01262-1)?

Verified Customer

Verified customer

Asked: 2019-12-18

Answer

We do provide the blocking peptide for product anti-Melanoma gp100/PMEL antibody (A01262-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-18

Question

Can you help my question with product A01262-1, anti-Melanoma gp100/PMEL antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-11

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01262-1 anti-Melanoma gp100/PMEL antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-11

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-06-27

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-27

Question

I see that the anti-Melanoma gp100/PMEL antibody A01262-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-06-17

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-06-17

Question

We want to test anti-Melanoma gp100/PMEL antibody A01262-1 on rat melanoma for research purposes, then I may be interested in using anti-Melanoma gp100/PMEL antibody A01262-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-17

Answer

The products we sell, including anti-Melanoma gp100/PMEL antibody A01262-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-17

Question

We need using your anti-Melanoma gp100/PMEL antibody for melanin biosynthetic process studies. Has this antibody been tested with western blotting on rat heart tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-05-17

Answer

We appreciate your inquiry. This A01262-1 anti-Melanoma gp100/PMEL antibody is tested on rat heart tissue, tissue lysate, mouse heart tissue. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-05-17

Question

I was wanting to use your anti-Melanoma gp100/PMEL antibody for WB for rat melanoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat melanoma identification?

A. Parker

Verified customer

Asked: 2017-01-09

Answer

As indicated on the product datasheet, A01262-1 anti-Melanoma gp100/PMEL antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat melanoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-01-09

Question

Please see the WB image, lot number and protocol we used for melanoma using anti-Melanoma gp100/PMEL antibody A01262-1. Please let me know if you require anything else.

P. Carter

Verified customer

Asked: 2015-12-23

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-12-23

Question

Is this A01262-1 anti-Melanoma gp100/PMEL antibody reactive to the isotypes of PMEL?

S. Parker

Verified customer

Asked: 2014-09-26

Answer

The immunogen of A01262-1 anti-Melanoma gp100/PMEL antibody is A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-09-26

Question

We were well pleased with the WB result of your anti-Melanoma gp100/PMEL antibody. However we have been able to see positive staining in placenta spleen endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is PMEL supposed to be expressed?

S. Collins

Verified customer

Asked: 2013-03-06

Answer

From literature, placenta spleen does express PMEL. Generally PMEL expresses in endoplasmic reticulum membrane. Regarding which tissues have PMEL expression, here are a few articles citing expression in various tissues:
Melanoma, Pubmed ID: 12643545, 17081065
Placenta, Pubmed ID: 15489334
Placenta, and Spleen, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2013-03-06

Order DetailsPrice
A01262-1

100μg

$370
A01262-1-10ug

10μg sample (liquid)

$99
A01262-1-Biotin

100 μg Biotin conjugated

$570
A01262-1-Cy3

100 μg Cy3 conjugated

$570
A01262-1-Dylight488

100 μg Dylight488 conjugated

$570
A01262-1-Dylight550

100 μg Dylight550 conjugated

$570
A01262-1-Dylight594

100 μg Dylight594 conjugated

$570
A01262-1-FITC

100 μg FITC conjugated

$570
A01262-1-HRP

100 μg HRP conjugated

$570
A01262-1-APC

100 μg APC conjugated

$670
A01262-1-PE

100 μg PE conjugated

$670
A01262-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01262-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.