Click image to see more details
Product Info Summary
| SKU: | PB9807 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Kv1.4/KCNA4 Antibody Picoband®
SKU/Catalog Number
PB9807
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Kv1.4/KCNA4 Antibody Picoband® catalog # PB9807. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Kv1.4/KCNA4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9807)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4, different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9807 is reactive to KCNA4 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
73 kDa
Calculated molecular weight
73257 MW
Background of Kv1.4
Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9807 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: HELA Whole Cell, COLO320 Whole Cell, HT1080 Whole Cell, PANC Whole Cell
IHC: human lung cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Kv1.4 using anti-Kv1.4 antibody (PB9807).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40 ug of sample under reducing conditions.
Lane 1: HELA Whole Cell Lysate,
Lane 2: COLO320 Whole Cell Lysate,
Lane 3: HT1080 Whole Cell Lysate,
Lane 4: PANC Whole Cell Lysate.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Kv1.4 antigen affinity purified polyclonal antibody (Catalog # PB9807) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Kv1.4 at approximately 73 kDa. The expected band size for Kv1.4 is at 73 kDa.
Click image to see more details
Figure 2. IHC analysis of Kv1.4 using anti-Kv1.4 antibody (PB9807).
Kv1.4 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Kv1.4 Antibody (PB9807) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For KCNA4 (Source: Uniprot.org, NCBI)
Gene Name
KCNA4
Full Name
Potassium voltage-gated channel subfamily A member 4
Weight
73257 MW
Superfamily
potassium channel family
Alternative Names
Potassium voltage-gated channel subfamily A member 4;HPCN2;Voltage-gated K (+) channel HuKII ;Voltage-gated potassium channel HBK4;Voltage-gated potassium channel HK1 ;Voltage-gated potassium channel subunit Kv1.4;KCNA4;KCNA4L; KCNA4 HBK4, HK1, HPCN2, HUKIIL, KCNA8, KV1.4, MCIDDS, PCN2, KCNA4 potassium voltage-gated channel subfamily A member 4 potassium voltage-gated channel subfamily A member 4|cardiac potassium channel|fetal skeletal muscle potassium channel|potassium channel 2|potassium channel, voltage gated shaker related subfamily A, member 4|rapidly inactivating potassium channel|shaker-related potassium channel Kv1.4|type A potassium channel|voltage-gated K(+) channel HuKII|voltage-gated potassium channel HBK4|voltage-gated potassium channel HK1|voltage-gated potassium channel subunit Kv1.4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on KCNA4, check out the KCNA4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for KCNA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Kv1.4/KCNA4 Antibody Picoband® (PB9807)
Hello CJ!
No publications found for PB9807
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Kv1.4/KCNA4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Kv1.4/KCNA4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Kv1.4/KCNA4 Antibody Picoband®
Question
I was wanting to use your anti-Kv1.4/KCNA4 antibody for IHC for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2018-07-02
Answer
It shows on the product datasheet, PB9807 anti-Kv1.4/KCNA4 antibody has been validated for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-07-02
Question
Is this PB9807 anti-Kv1.4/KCNA4 antibody reactive to the isotypes of KCNA4?
C. Yang
Verified customer
Asked: 2015-12-23
Answer
The immunogen of PB9807 anti-Kv1.4/KCNA4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2015-12-23
Question
We are currently using anti-Kv1.4/KCNA4 antibody PB9807 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?
L. Carter
Verified customer
Asked: 2014-11-06
Answer
The anti-Kv1.4/KCNA4 antibody (PB9807) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-11-06
Question
I would like to test anti-Kv1.4/KCNA4 antibody PB9807 on human brain for research purposes, then I may be interested in using anti-Kv1.4/KCNA4 antibody PB9807 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
N. Edwards
Verified customer
Asked: 2014-04-02
Answer
The products we sell, including anti-Kv1.4/KCNA4 antibody PB9807, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-04-02
