Anti-Kv1.4/KCNA4 Antibody Picoband®

Kv1.4 antibody

Boster Bio Anti-Kv1.4/KCNA4 Antibody Picoband® catalog # PB9807. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9807
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Kv1.4/KCNA4 Antibody Picoband®

View all Kv1.4 Antibodies

SKU/Catalog Number

PB9807

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Kv1.4/KCNA4 Antibody Picoband® catalog # PB9807. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Kv1.4/KCNA4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9807)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4, different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9807 is reactive to KCNA4 in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

73 kDa

Calculated molecular weight

73257 MW

Background of Kv1.4

Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9807 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: HELA Whole Cell, COLO320 Whole Cell, HT1080 Whole Cell, PANC Whole Cell
IHC: human lung cancer tissue

Validation Images & Assay Conditions

Gene/Protein Information For KCNA4 (Source: Uniprot.org, NCBI)

Gene Name

KCNA4

Full Name

Potassium voltage-gated channel subfamily A member 4

Weight

73257 MW

Superfamily

potassium channel family

Alternative Names

Potassium voltage-gated channel subfamily A member 4;HPCN2;Voltage-gated K (+) channel HuKII ;Voltage-gated potassium channel HBK4;Voltage-gated potassium channel HK1 ;Voltage-gated potassium channel subunit Kv1.4;KCNA4;KCNA4L; KCNA4 HBK4, HK1, HPCN2, HUKIIL, KCNA8, KV1.4, MCIDDS, PCN2, KCNA4 potassium voltage-gated channel subfamily A member 4 potassium voltage-gated channel subfamily A member 4|cardiac potassium channel|fetal skeletal muscle potassium channel|potassium channel 2|potassium channel, voltage gated shaker related subfamily A, member 4|rapidly inactivating potassium channel|shaker-related potassium channel Kv1.4|type A potassium channel|voltage-gated K(+) channel HuKII|voltage-gated potassium channel HBK4|voltage-gated potassium channel HK1|voltage-gated potassium channel subunit Kv1.4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on KCNA4, check out the KCNA4 Infographic

KCNA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCNA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9807

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Kv1.4/KCNA4 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Kv1.4/KCNA4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Kv1.4/KCNA4 Antibody Picoband®

Question

I was wanting to use your anti-Kv1.4/KCNA4 antibody for IHC for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?

Verified Customer

Verified customer

Asked: 2018-07-02

Answer

It shows on the product datasheet, PB9807 anti-Kv1.4/KCNA4 antibody has been validated for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-07-02

Question

Is this PB9807 anti-Kv1.4/KCNA4 antibody reactive to the isotypes of KCNA4?

C. Yang

Verified customer

Asked: 2015-12-23

Answer

The immunogen of PB9807 anti-Kv1.4/KCNA4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-12-23

Question

We are currently using anti-Kv1.4/KCNA4 antibody PB9807 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on monkey tissues as well?

L. Carter

Verified customer

Asked: 2014-11-06

Answer

The anti-Kv1.4/KCNA4 antibody (PB9807) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-11-06

Question

I would like to test anti-Kv1.4/KCNA4 antibody PB9807 on human brain for research purposes, then I may be interested in using anti-Kv1.4/KCNA4 antibody PB9807 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

N. Edwards

Verified customer

Asked: 2014-04-02

Answer

The products we sell, including anti-Kv1.4/KCNA4 antibody PB9807, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2014-04-02

Order DetailsPrice
PB9807

100μg

$370
PB9807-10ug

10μg sample (liquid)

$99
PB9807-Biotin

100 μg Biotin conjugated

$570
PB9807-Cy3

100 μg Cy3 conjugated

$570
PB9807-Dylight488

100 μg Dylight488 conjugated

$570
PB9807-Dylight550

100 μg Dylight550 conjugated

$570
PB9807-Dylight594

100 μg Dylight594 conjugated

$570
PB9807-FITC

100 μg FITC conjugated

$570
PB9807-HRP

100 μg HRP conjugated

$570
PB9807-APC

100 μg APC conjugated

$670
PB9807-PE

100 μg PE conjugated

$670
PB9807-iFluor647

100 μg iFluor647 conjugated

$670
PB9807-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9807
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product