Click image to see more details
Product Info Summary
| SKU: | A01364-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-KiSS1 receptor/KISS1R Antibody Picoband®
View all KiSS1R/GPR54 Antibodies
SKU/Catalog Number
A01364-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-KiSS1 receptor/KISS1R Antibody Picoband® catalog # A01364-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-KiSS1 receptor/KISS1R Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01364-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human KiSS1 receptor, which shares 82.4% amino acid (aa) sequence identity with both mouse and rat KiSS1 receptor.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01364-1 is reactive to KISS1R in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
43 kDa
Calculated molecular weight
42.889kDa
Background of KiSS1R/GPR54
The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds the peptide hormone kisspeptin (metastin). Kisspeptin is involved in the regulation of endocrine function and the onset of puberty, with activation of the kisspeptin receptor triggering release of gonadotropin-releasing hormone (GnRH), and release of kisspeptin itself being inhibited by oestradiol but enhanced by GnRH. Reductions in kisspeptin levels with age may conversely be one of the reasons behind age-related declines in levels of other endocrine hormones such as luteinizing hormone.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01364-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human WISH whole cell, human HepG2 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of KiSS1 receptor using anti-KiSS1 receptor antibody (A01364-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human WISH whole cell lysates,
Lane 2: human HepG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KiSS1 receptor antigen affinity purified polyclonal antibody (Catalog # A01364-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for KiSS1 receptor at approximately 43KD. The expected band size for KiSS1 receptor is at 43KD.
Protein Target Info & Infographic
Gene/Protein Information For KISS1R (Source: Uniprot.org, NCBI)
Gene Name
KISS1R
Full Name
KiSS-1 receptor
Weight
42.889kDa
Superfamily
G-protein coupled receptor 1 family
Alternative Names
KiSS-1 receptor; KiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; hOT7T175; Hypogonadotropin-1; Kisspeptins receptor; Metastin receptor; KISS1R; AXOR12; GPR54 Kiss1r|Gpr54|KISS1 receptor|kiSS-1 receptor|G protein-coupled receptor 54|G-protein coupled receptor OT7T175|kiSS-|kiSS-1R|kisspeptins receptor|metastin receptor|orphan G protein-coupled receptor GPR54|rOT7T175
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on KISS1R, check out the KISS1R Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for KISS1R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-KiSS1 receptor/KISS1R Antibody Picoband® (A01364-1)
Hello CJ!
No publications found for A01364-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-KiSS1 receptor/KISS1R Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-KiSS1 receptor/KISS1R Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-KiSS1 receptor/KISS1R Antibody Picoband®
Question
Is this A01364-1 anti-KiSS1 receptor/KISS1R antibody reactive to the isotypes of KISS1R?
Verified Customer
Verified customer
Asked: 2020-03-12
Answer
The immunogen of A01364-1 anti-KiSS1 receptor/KISS1R antibody is A synthetic peptide corresponding to a sequence of human KiSS1 receptor (MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-12
Question
Is a blocking peptide available for product anti-KiSS1 receptor/KISS1R antibody (A01364-1)?
Verified Customer
Verified customer
Asked: 2020-01-28
Answer
We do provide the blocking peptide for product anti-KiSS1 receptor/KISS1R antibody (A01364-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-28
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-KiSS1 receptor/KISS1R antibody A01364-1. Let me know if you need anything else.
L. Krishna
Verified customer
Asked: 2019-11-06
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-06
Question
We are currently using anti-KiSS1 receptor/KISS1R antibody A01364-1 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-21
Answer
The anti-KiSS1 receptor/KISS1R antibody (A01364-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-21
Question
Does anti-KiSS1 receptor/KISS1R antibody A01364-1 work for WB with brain?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
According to the expression profile of brain, KISS1R is highly expressed in brain. So, it is likely that anti-KiSS1 receptor/KISS1R antibody A01364-1 will work for WB with brain.
Boster Scientific Support
Answered: 2019-05-31
Question
I would like to test anti-KiSS1 receptor/KISS1R antibody A01364-1 on mouse brain for research purposes, then I may be interested in using anti-KiSS1 receptor/KISS1R antibody A01364-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
M. Dhar
Verified customer
Asked: 2018-05-08
Answer
The products we sell, including anti-KiSS1 receptor/KISS1R antibody A01364-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-05-08
