Product Info Summary
SKU: | PB9480 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-KIAA0652/ATG13 Antibody Picoband®
SKU/Catalog Number
PB9480
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-KIAA0652/ATG13 Antibody Picoband® catalog # PB9480. Tested in WB applications. This antibody reacts with Human, Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-KIAA0652/ATG13 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9480)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Standard Protein
A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9480 is reactive to ATG13 in Human, Mouse
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
56 kDa
Calculated molecular weight
56572 MW
Background of ATG13
Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9480 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse
Positive Control
WB: Human Placenta Tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of KIAA0652 using anti-KIAA0652 antibody (PB9480).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Human Placenta Tissue Lysate at 50ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KIAA0652 antigen affinity purified polyclonal antibody (Catalog # PB9480) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for KIAA0652 at approximately 56 kDa. The expected band size for KIAA0652 is at 56 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ATG13 (Source: Uniprot.org, NCBI)
Gene Name
ATG13
Full Name
Autophagy-related protein 13
Weight
56572 MW
Superfamily
ATG13 family
Alternative Names
autophagy-related protein 13; autophagy related 13; KIAA0652 ATG13 KIAA0652, PARATARG8 autophagy related 13 autophagy-related protein 13|ATG13 autophagy related 13 homolog
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ATG13, check out the ATG13 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ATG13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-KIAA0652/ATG13 Antibody Picoband® (PB9480)
Hello CJ!
No publications found for PB9480
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-KIAA0652/ATG13 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-KIAA0652/ATG13 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-KIAA0652/ATG13 Antibody Picoband®
Question
I was wanting to use your anti-KIAA0652/ATG13 antibody for WB for mouse brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse brain identification?
Verified Customer
Verified customer
Asked: 2020-04-17
Answer
It shows on the product datasheet, PB9480 anti-KIAA0652/ATG13 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-04-17
Question
We are currently using anti-KIAA0652/ATG13 antibody PB9480 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it likely that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-12-24
Answer
The anti-KIAA0652/ATG13 antibody (PB9480) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-24
Question
Is this PB9480 anti-KIAA0652/ATG13 antibody reactive to the isotypes of ATG13?
T. Taylor
Verified customer
Asked: 2019-08-20
Answer
The immunogen of PB9480 anti-KIAA0652/ATG13 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-20
Question
I see that the anti-KIAA0652/ATG13 antibody PB9480 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-02-06
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-02-06