Anti-JAK1 Antibody Picoband™

JAK1 antibody

Boster Bio Anti-JAK1 Antibody Picoband™ catalog # A00330. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A00330
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-JAK1 Antibody Picoband™

View all JAK1 Antibodies

SKU/Catalog Number

A00330

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-JAK1 Antibody Picoband™ catalog # A00330. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-JAK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00330)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1, different from the related mouse sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00330 is reactive to JAK1 in Human, Mouse, Rat

Applications

A00330 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

133 kDa

Calculated molecular weight

133277 MW

Background of JAK1

JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-α/β) and type II (IFN-γ) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For JAK1 (Source: Uniprot.org, NCBI)

Gene Name

JAK1

Full Name

Tyrosine-protein kinase JAK1

Weight

133277 MW

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.10; Jak1; JAK-1; JAK1Atyrosine-protein kinase JAK1; JAK1B; Janus kinase 1EC 2.7.10.2; JTK3 JAK1 AIIDEA, JAK1B, JTK3, JAK1 Janus kinase 1 tyrosine-protein kinase JAK1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on JAK1, check out the JAK1 Infographic

JAK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for JAK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00330 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway

Zhang T,Ma L,Wu P,Li W,Li T,Gu R,Dan X,Li Z,Fan X,Xiao Z.Gallic acid has anticancer activity and enhances the anticancer effects of cisplatin in non‑small cell lung cancer A549 cells via the JAK/STAT3 signaling pathway.Oncol Rep.2019 Mar;41(3):1779-1788.doi:10.3892/or.2019.6976.Epub 2019 Jan 22.PMID:30747218.
Species: Human
A00330 usage in article: APP:WB, SAMPLE:A549 CELL, DILUTION:1:1000

Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway

Have you used Anti-JAK1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-JAK1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-JAK1 Antibody Picoband™

Question

We are currently using anti-JAK1 antibody A00330 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

The anti-JAK1 antibody (A00330) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-12

Question

My question regards using your anti-JAK1 antibody for interleukin-15 signaling studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-02-25

Answer

We appreciate your inquiry. This A00330 anti-JAK1 antibody is tested on rat kidney, mouse kidney, hela whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-02-25

Question

I see that the anti-JAK1 antibody A00330 works with WB, what is the protocol used to produce the result images on the product page?

R. Johnson

Verified customer

Asked: 2019-12-31

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-12-31

Question

I have a question about product A00330, anti-JAK1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-08

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00330 anti-JAK1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-08

Question

We have been able to see staining in mouse blood. Are there any suggestions? Is anti-JAK1 antibody supposed to stain blood positively?

Verified Customer

Verified customer

Asked: 2019-09-12

Answer

From literature blood does express JAK1. From Uniprot.org, JAK1 is expressed in blood, brain, colon tumor, liver, among other tissues. Regarding which tissues have JAK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 16710414
Colon tumor, Pubmed ID: 7896447
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2019-09-12

Question

Is a blocking peptide available for product anti-JAK1 antibody (A00330)?

Verified Customer

Verified customer

Asked: 2019-09-05

Answer

We do provide the blocking peptide for product anti-JAK1 antibody (A00330). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-09-05

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-JAK1 antibody A00330. Let me know if you need anything else.

R. Taylor

Verified customer

Asked: 2019-08-07

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-07

Question

See attached the WB image, lot number and protocol we used for liver using anti-JAK1 antibody A00330. Please let me know if you require anything else.

L. Lewis

Verified customer

Asked: 2019-07-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-22

Question

I would like to test anti-JAK1 antibody A00330 on human liver for research purposes, then I may be interested in using anti-JAK1 antibody A00330 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-08-20

Answer

The products we sell, including anti-JAK1 antibody A00330, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-08-20

Question

Our team were content with the WB result of your anti-JAK1 antibody. However we have been able to see positive staining in liver endomembrane system using this antibody. Is that expected? Could you tell me where is JAK1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-02-14

Answer

According to literature, liver does express JAK1. Generally JAK1 expresses in endomembrane system. Regarding which tissues have JAK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 16710414
Colon tumor, Pubmed ID: 7896447
Liver, Pubmed ID: 24275569

Boster Scientific Support

Answered: 2018-02-14

Question

I was wanting to use your anti-JAK1 antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?

Verified Customer

Verified customer

Asked: 2017-05-25

Answer

You can see on the product datasheet, A00330 anti-JAK1 antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-05-25

Question

Will anti-JAK1 antibody A00330 work for WB with liver?

P. Dhar

Verified customer

Asked: 2016-11-15

Answer

According to the expression profile of liver, JAK1 is highly expressed in liver. So, it is likely that anti-JAK1 antibody A00330 will work for WB with liver.

Boster Scientific Support

Answered: 2016-11-15

Question

Do you have a BSA free version of anti-JAK1 antibody A00330 available?

R. Evans

Verified customer

Asked: 2015-10-22

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-JAK1 antibody A00330 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2015-10-22

Question

Does A00330 anti-JAK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

D. Evans

Verified customer

Asked: 2015-08-18

Answer

As indicated on the product datasheet, A00330 anti-JAK1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2015-08-18

Question

Is this A00330 anti-JAK1 antibody reactive to the isotypes of JAK1?

M. Wu

Verified customer

Asked: 2013-12-27

Answer

The immunogen of A00330 anti-JAK1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-12-27

Order DetailsPrice
A00330

100μg

$370
A00330-10ug

10μg sample (liquid)

$99
A00330-Biotin

100 μg Biotin conjugated

$570
A00330-Cy3

100 μg Cy3 conjugated

$570
A00330-Dylight488

100 μg Dylight488 conjugated

$570
A00330-Dylight550

100 μg Dylight550 conjugated

$570
A00330-Dylight594

100 μg Dylight594 conjugated

$570
A00330-FITC

100 μg FITC conjugated

$570
A00330-HRP

100 μg HRP conjugated

$570
A00330-APC

100 μg APC conjugated

$670
A00330-PE

100 μg PE conjugated

$670
A00330-iFluor647

100 μg iFluor647 conjugated

$670
A00330-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00330
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.