Click image to see more details
Product Info Summary
| SKU: | PB9948 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-IL7R alpha Antibody Picoband®
View all IL-7R alpha/CD127 Antibodies
SKU/Catalog Number
PB9948
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-IL7R alpha Antibody Picoband® catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-IL7R alpha Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9948)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha, different from the related mouse sequence by nine amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9948 is reactive to IL7R in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
70 kDa
Calculated molecular weight
51581 MW
Background of IL-7R alpha/CD127
The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V (D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9948 is guaranteed for Flow Cytometry, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: 22RV1 whole cell
FCM: U20S cell, U87 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of IL7R alpha using anti-IL7R alpha antibody (PB9948).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: 22RV1 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IL7R alpha antigen affinity purified polyclonal antibody (Catalog # PB9948) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IL7R alpha at approximately 70KD. The expected band size for IL7R alpha is at 70KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of U20S cells using anti-IL7R alpha antibody (PB9948).
Overlay histogram showing U20S cells stained with PB9948 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IL7R alpha Antibody (PB9948,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Click image to see more details
Figure 3. Flow Cytometry analysis of U87 cells using anti-IL7R alpha antibody (PB9948).
Overlay histogram showing U87 cells stained with PB9948 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IL7R alpha Antibody (PB9948,1μg/1x106 cells) for 30 min at 20°C. DyLight488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For IL7R (Source: Uniprot.org, NCBI)
Gene Name
IL7R
Full Name
Interleukin-7 receptor subunit alpha
Weight
51581 MW
Superfamily
type I cytokine receptor family
Alternative Names
Interleukin-7 receptor subunit alpha;IL-7 receptor subunit alpha;IL-7R subunit alpha;IL-7R-alpha;IL-7RA;CDw127;CD127;IL7R; IL7R CD127, CDW127, IL-7R-alphaA, ILRA, IL7R interleukin 7 receptor interleukin-7 receptor subunit alpha|CD127 |IL-7 receptor subunit alpha|IL-7R subunit alpha|interleukin 7 receptor alpha chain
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on IL7R, check out the IL7R Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL7R: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-IL7R alpha Antibody Picoband® (PB9948)
Hello CJ!
No publications found for PB9948
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-IL7R alpha Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-IL7R alpha Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
3 Customer Q&As for Anti-IL7R alpha Antibody Picoband®
Question
We are currently using anti-IL7R alpha antibody PB9948 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on pig tissues as well?
K. Parker
Verified customer
Asked: 2019-08-06
Answer
The anti-IL7R alpha antibody (PB9948) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-06
Question
Is this PB9948 anti-IL7R alpha antibody reactive to the isotypes of IL7R?
Verified Customer
Verified customer
Asked: 2017-09-26
Answer
The immunogen of PB9948 anti-IL7R alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2017-09-26
Question
PB9948 PB9199 Could you let me know if these will pass FLOW?
Verified Customer
Verified customer
Asked: 2014-12-26
Answer
PB9948 passed FLOW. PB9919 failed.
Boster Scientific Support
Answered: 2014-12-26
