Anti-IFNAR1 Antibody Picoband®

IFN-alpha/beta R1 antibody

Boster Bio Anti-IFNAR1 Antibody Picoband® catalog # A00306-2. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A00306-2
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-IFNAR1 Antibody Picoband®

View all IFN-alpha/beta R1 Antibodies

SKU/Catalog Number

A00306-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IFNAR1 Antibody Picoband® catalog # A00306-2. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IFNAR1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00306-2)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00306-2 is reactive to IFNAR1 in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

130 kDa

Calculated molecular weight

63525 MW

Background of IFN-alpha/beta R1

Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00306-2 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: human A431 whole cell, human K562 whole cell, human HEL whole cell

Validation Images & Assay Conditions

Gene/Protein Information For IFNAR1 (Source: Uniprot.org, NCBI)

Gene Name

IFNAR1

Full Name

Interferon alpha/beta receptor 1

Weight

63525 MW

Superfamily

type II cytokine receptor family

Alternative Names

Interferon alpha/beta receptor 1;IFN-R-1;IFN-alpha/beta receptor 1;Cytokine receptor class-II member 1;Cytokine receptor family 2 member 1;CRF2-1;Type I interferon receptor 1;IFNAR1;IFNAR; IFNAR1 AVP, IFN-alpha-REC, IFNAR, IFNBR, IFRC interferon alpha and beta receptor subunit 1 interferon alpha/beta receptor 1|CRF2-1|IFN-R-1|IFN-alpha/beta receptor 1|IFNalpha/beta receptor 1|alpha-type antiviral protein|beta-type antiviral protein|cytokine receptor class-II member 1|cytokine receptor family 2 member 1|interferon (alpha, beta and omega) receptor 1|interferon receptor 1|interferon-alpha/beta receptor alpha chain|interferon-beta receptor 1|type I interferon receptor 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on IFNAR1, check out the IFNAR1 Infographic

IFNAR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IFNAR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00306-2 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Preparation and characterization of latex films photo-immobilized with IFN-α

Have you used Anti-IFNAR1 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-IFNAR1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-IFNAR1 Antibody Picoband®

Question

Could freeze-thaw affect the performance of A00306-2?

Verified customer

Asked: 2022-04-22

Answer

No, but storing the antibody at room temperature for a long time might affect the performance of the Anti-IFNAR1 Antibody Picoband™ (A00306-2).

Boster Scientific Support

Answered: 2022-04-26

Question

Is there a BSA free version of anti-IFNAR1 antibody A00306-2 available?

Verified Customer

Verified customer

Asked: 2020-03-19

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-IFNAR1 antibody A00306-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-19

Question

I am looking for to test anti-IFNAR1 antibody A00306-2 on mouse lung for research purposes, then I may be interested in using anti-IFNAR1 antibody A00306-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-20

Answer

The products we sell, including anti-IFNAR1 antibody A00306-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-20

Question

Please see the WB image, lot number and protocol we used for lung using anti-IFNAR1 antibody A00306-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-02-18

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-18

Question

I was wanting to use your anti-IFNAR1 antibody for WB for mouse lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung identification?

Verified Customer

Verified customer

Asked: 2020-01-10

Answer

It shows on the product datasheet, A00306-2 anti-IFNAR1 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-01-10

Question

Does anti-IFNAR1 antibody A00306-2 work for WB with lung?

Verified Customer

Verified customer

Asked: 2019-12-25

Answer

According to the expression profile of lung, IFNAR1 is highly expressed in lung. So, it is likely that anti-IFNAR1 antibody A00306-2 will work for WB with lung.

Boster Scientific Support

Answered: 2019-12-25

Question

Is a blocking peptide available for product anti-IFNAR1 antibody (A00306-2)?

Verified Customer

Verified customer

Asked: 2019-11-26

Answer

We do provide the blocking peptide for product anti-IFNAR1 antibody (A00306-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-26

Question

We are currently using anti-IFNAR1 antibody A00306-2 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it possible that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-03

Answer

The anti-IFNAR1 antibody (A00306-2) has not been tested for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-03

Question

Will A00306-2 and M00139 be able to work on ELISA experiment?

Verified customer

Asked: 2019-06-17

Answer

The Anti-IFNAR1 Antibody Picoband™ (A00306-2) and Anti-MMP9 Rabbit Monoclonal Antibody (M00139 are not experimentally validated for the ELISA experiment. Please run a pilot test if you want to try.

Boster Scientific Support

Answered: 2019-06-17

Question

My question regarding product A00306-2, anti-IFNAR1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

M. Moore

Verified customer

Asked: 2019-05-31

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00306-2 anti-IFNAR1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-31

Question

I am interested in using your anti-IFNAR1 antibody for cytokine-mediated signaling pathway studies. Has this antibody been tested with western blotting on human a549? We would like to see some validation images before ordering.

T. Huang

Verified customer

Asked: 2019-04-09

Answer

We appreciate your inquiry. This A00306-2 anti-IFNAR1 antibody is validated on human a549, k562 whole cell lysates, a549 whole cell lysates, mouse lung tissue, brain tissue, testis tissue, stomach tissue, kidney tissue. It is guaranteed to work for WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-04-09

Question

Will A00306-2 anti-IFNAR1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-10-04

Answer

As indicated on the product datasheet, A00306-2 anti-IFNAR1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-10-04

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-IFNAR1 antibody A00306-2. Let me know if you need anything else.

M. Jackson

Verified customer

Asked: 2017-08-08

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-08-08

Question

Is this A00306-2 anti-IFNAR1 antibody reactive to the isotypes of IFNAR1?

S. Jones

Verified customer

Asked: 2016-10-26

Answer

The immunogen of A00306-2 anti-IFNAR1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-10-26

Question

We have been able to see staining in mouse brain ovary. What should we do? Is anti-IFNAR1 antibody supposed to stain brain ovary positively?

B. Johnson

Verified customer

Asked: 2015-10-26

Answer

From literature brain ovary does express IFNAR1. From Uniprot.org, IFNAR1 is expressed in leukocyte, lung, liver, brain ovary, myeloma, leukemic t-cell, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have IFNAR1 expression, here are a few articles citing expression in various tissues:
Brain, and Ovary, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 10830953
Lung, Pubmed ID: 14702039
Myeloma, Pubmed ID: 8307198

Boster Scientific Support

Answered: 2015-10-26

Question

I see that the anti-IFNAR1 antibody A00306-2 works with WB, what is the protocol used to produce the result images on the product page?

J. Dhar

Verified customer

Asked: 2014-06-03

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-06-03

Question

We were content with the WB result of your anti-IFNAR1 antibody. However we have seen positive staining in lung isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is IFNAR1 supposed to be expressed?

P. Miller

Verified customer

Asked: 2014-06-02

Answer

From literature, lung does express IFNAR1. Generally IFNAR1 expresses in isoform 1: cell membrane. Regarding which tissues have IFNAR1 expression, here are a few articles citing expression in various tissues:
Brain, and Ovary, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 10830953
Lung, Pubmed ID: 14702039
Myeloma, Pubmed ID: 8307198

Boster Scientific Support

Answered: 2014-06-02

Order DetailsPrice
A00306-2

100μg

$370
A00306-2-10ug

10μg sample (liquid)

$99
A00306-2-Biotin

100 μg Biotin conjugated

$570
A00306-2-Cy3

100 μg Cy3 conjugated

$570
A00306-2-Dylight488

100 μg Dylight488 conjugated

$570
A00306-2-Dylight550

100 μg Dylight550 conjugated

$570
A00306-2-Dylight594

100 μg Dylight594 conjugated

$570
A00306-2-FITC

100 μg FITC conjugated

$570
A00306-2-HRP

100 μg HRP conjugated

$570
A00306-2-APC

100 μg APC conjugated

$670
A00306-2-PE

100 μg PE conjugated

$670
A00306-2-iFluor647

100 μg iFluor647 conjugated

$670
A00306-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00306-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.