Product Info Summary
SKU: | A00306-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-IFNAR1 Antibody Picoband®
View all IFN-alpha/beta R1 Antibodies
SKU/Catalog Number
A00306-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-IFNAR1 Antibody Picoband® catalog # A00306-2. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-IFNAR1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00306-2)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00306-2 is reactive to IFNAR1 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
130 kDa
Calculated molecular weight
63525 MW
Background of IFN-alpha/beta R1
Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00306-2 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Positive Control
WB: human A431 whole cell, human K562 whole cell, human HEL whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of IFNAR1 using anti-IFNAR1 antibody (A00306-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human A431 whole cell lysates,
Lane 2: human K562 whole cell lysates,
Lane 3: human HEL whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IFNAR1 antigen affinity purified polyclonal antibody (Catalog # A00306-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IFNAR1 at approximately 130 kDa. The expected band size for IFNAR1 is at 64 kDa.
Protein Target Info & Infographic
Gene/Protein Information For IFNAR1 (Source: Uniprot.org, NCBI)
Gene Name
IFNAR1
Full Name
Interferon alpha/beta receptor 1
Weight
63525 MW
Superfamily
type II cytokine receptor family
Alternative Names
Interferon alpha/beta receptor 1;IFN-R-1;IFN-alpha/beta receptor 1;Cytokine receptor class-II member 1;Cytokine receptor family 2 member 1;CRF2-1;Type I interferon receptor 1;IFNAR1;IFNAR; IFNAR1 AVP, IFN-alpha-REC, IFNAR, IFNBR, IFRC interferon alpha and beta receptor subunit 1 interferon alpha/beta receptor 1|CRF2-1|IFN-R-1|IFN-alpha/beta receptor 1|IFNalpha/beta receptor 1|alpha-type antiviral protein|beta-type antiviral protein|cytokine receptor class-II member 1|cytokine receptor family 2 member 1|interferon (alpha, beta and omega) receptor 1|interferon receptor 1|interferon-alpha/beta receptor alpha chain|interferon-beta receptor 1|type I interferon receptor 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on IFNAR1, check out the IFNAR1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNAR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-IFNAR1 Antibody Picoband® (A00306-2)
Hello CJ!
A00306-2 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Preparation and characterization of latex films photo-immobilized with IFN-α
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-IFNAR1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-IFNAR1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
17 Customer Q&As for Anti-IFNAR1 Antibody Picoband®
Question
Could freeze-thaw affect the performance of A00306-2?
Verified customer
Asked: 2022-04-22
Answer
No, but storing the antibody at room temperature for a long time might affect the performance of the Anti-IFNAR1 Antibody Picoband™ (A00306-2).
Boster Scientific Support
Answered: 2022-04-26
Question
Is there a BSA free version of anti-IFNAR1 antibody A00306-2 available?
Verified Customer
Verified customer
Asked: 2020-03-19
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-IFNAR1 antibody A00306-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-19
Question
I am looking for to test anti-IFNAR1 antibody A00306-2 on mouse lung for research purposes, then I may be interested in using anti-IFNAR1 antibody A00306-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-02-20
Answer
The products we sell, including anti-IFNAR1 antibody A00306-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-20
Question
Please see the WB image, lot number and protocol we used for lung using anti-IFNAR1 antibody A00306-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-18
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-18
Question
I was wanting to use your anti-IFNAR1 antibody for WB for mouse lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung identification?
Verified Customer
Verified customer
Asked: 2020-01-10
Answer
It shows on the product datasheet, A00306-2 anti-IFNAR1 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-01-10
Question
Does anti-IFNAR1 antibody A00306-2 work for WB with lung?
Verified Customer
Verified customer
Asked: 2019-12-25
Answer
According to the expression profile of lung, IFNAR1 is highly expressed in lung. So, it is likely that anti-IFNAR1 antibody A00306-2 will work for WB with lung.
Boster Scientific Support
Answered: 2019-12-25
Question
Is a blocking peptide available for product anti-IFNAR1 antibody (A00306-2)?
Verified Customer
Verified customer
Asked: 2019-11-26
Answer
We do provide the blocking peptide for product anti-IFNAR1 antibody (A00306-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-26
Question
We are currently using anti-IFNAR1 antibody A00306-2 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it possible that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-03
Answer
The anti-IFNAR1 antibody (A00306-2) has not been tested for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-03
Question
Will A00306-2 and M00139 be able to work on ELISA experiment?
Verified customer
Asked: 2019-06-17
Answer
The Anti-IFNAR1 Antibody Picoband™ (A00306-2) and Anti-MMP9 Rabbit Monoclonal Antibody (M00139 are not experimentally validated for the ELISA experiment. Please run a pilot test if you want to try.
Boster Scientific Support
Answered: 2019-06-17
Question
My question regarding product A00306-2, anti-IFNAR1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
M. Moore
Verified customer
Asked: 2019-05-31
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00306-2 anti-IFNAR1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-05-31
Question
I am interested in using your anti-IFNAR1 antibody for cytokine-mediated signaling pathway studies. Has this antibody been tested with western blotting on human a549? We would like to see some validation images before ordering.
T. Huang
Verified customer
Asked: 2019-04-09
Answer
We appreciate your inquiry. This A00306-2 anti-IFNAR1 antibody is validated on human a549, k562 whole cell lysates, a549 whole cell lysates, mouse lung tissue, brain tissue, testis tissue, stomach tissue, kidney tissue. It is guaranteed to work for WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-04-09
Question
Will A00306-2 anti-IFNAR1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-10-04
Answer
As indicated on the product datasheet, A00306-2 anti-IFNAR1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-10-04
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-IFNAR1 antibody A00306-2. Let me know if you need anything else.
M. Jackson
Verified customer
Asked: 2017-08-08
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-08-08
Question
Is this A00306-2 anti-IFNAR1 antibody reactive to the isotypes of IFNAR1?
S. Jones
Verified customer
Asked: 2016-10-26
Answer
The immunogen of A00306-2 anti-IFNAR1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2016-10-26
Question
We have been able to see staining in mouse brain ovary. What should we do? Is anti-IFNAR1 antibody supposed to stain brain ovary positively?
B. Johnson
Verified customer
Asked: 2015-10-26
Answer
From literature brain ovary does express IFNAR1. From Uniprot.org, IFNAR1 is expressed in leukocyte, lung, liver, brain ovary, myeloma, leukemic t-cell, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have IFNAR1 expression, here are a few articles citing expression in various tissues:
Brain, and Ovary, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 10830953
Lung, Pubmed ID: 14702039
Myeloma, Pubmed ID: 8307198
Boster Scientific Support
Answered: 2015-10-26
Question
I see that the anti-IFNAR1 antibody A00306-2 works with WB, what is the protocol used to produce the result images on the product page?
J. Dhar
Verified customer
Asked: 2014-06-03
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-06-03
Question
We were content with the WB result of your anti-IFNAR1 antibody. However we have seen positive staining in lung isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is IFNAR1 supposed to be expressed?
P. Miller
Verified customer
Asked: 2014-06-02
Answer
From literature, lung does express IFNAR1. Generally IFNAR1 expresses in isoform 1: cell membrane. Regarding which tissues have IFNAR1 expression, here are a few articles citing expression in various tissues:
Brain, and Ovary, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19349973, 19690332
Liver, Pubmed ID: 10830953
Lung, Pubmed ID: 14702039
Myeloma, Pubmed ID: 8307198
Boster Scientific Support
Answered: 2014-06-02