Product Info Summary
SKU: | M02389-Dyl550 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Mouse |
Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)
View all TCP1 alpha Antibodies
SKU/Catalog Number
M02389-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody (monoclonal, 2E7) catalog # M02389-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M02389-Dyl550)
Host
Mouse
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Monoclonal
Clone Number
Clone: 2E7
Isotype
Mouse IgG1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha, different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
M02389-Dyl550 is reactive to TCP1 in Human
Applications
M02389-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
Background of TCP1 alpha
T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
![boster box boster box](https://www.bosterbio.com/media/catalog/product/b/o/boster-box.png)
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For TCP1 (Source: Uniprot.org, NCBI)
Gene Name
TCP1
Full Name
T-complex protein 1 subunit alpha
Weight
Superfamily
TCP-1 chaperonin family
Alternative Names
CCT1T-complex protein 1 subunit alpha; CCTa; CCT-alpha; D6S230E; tailless complex polypeptide 1; t-complex 1; T-complex protein 1, alpha subunit; TCP-1-alpha TCP1 CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha t-complex 1 T-complex protein 1 subunit alpha|T-complex protein 1, alpha subunit|t-complex 1 protein|tailless complex polypeptide 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on TCP1, check out the TCP1 Infographic
![TCP1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TCP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7) (M02389-Dyl550)
Hello CJ!
No publications found for M02389-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)
Question
Is this M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) reactive to the isotypes of TCP1?
Verified Customer
Verified customer
Asked: 2019-06-18
Answer
The immunogen of M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) is A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-06-18
Question
Would anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 work for Flow Cytometry with testis?
R. Thomas
Verified customer
Asked: 2017-06-12
Answer
According to the expression profile of testis, TCP1 is highly expressed in testis. So, it is likely that anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 will work for Flow Cytometry with testis.
Boster Scientific Support
Answered: 2017-06-12
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550. Let me know if you need anything else.
O. Brown
Verified customer
Asked: 2016-10-11
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-10-11
Question
I was wanting to use your anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) for Flow Cytometry for human testis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human testis identification?
F. Bhatt
Verified customer
Asked: 2016-09-26
Answer
As indicated on the product datasheet, M02389-Dyl550 anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human testis in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-09-26
Question
I am interested in to test anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 on human testis for research purposes, then I may be interested in using anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
K. Kulkarni
Verified customer
Asked: 2014-02-24
Answer
The products we sell, including anti-Human TCP1 alpha DyLight® 550 conjugated antibody(monoclonal, 2E7) M02389-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-02-24