Product Info Summary
SKU: | M00949-Dyl550 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Mouse |
Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5)
View all HSP70/HSPA1A Antibodies
SKU/Catalog Number
M00949-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody (monoclonal, 3H5) catalog # M00949-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00949-Dyl550)
Host
Mouse
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Monoclonal
Clone Number
3H5
Isotype
Mouse IgG1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70, different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
M00949-Dyl550 is reactive to HSPA1A in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
70.052kDa
Background of HSP70/HSPA1A
HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
M00949-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For HSPA1A (Source: Uniprot.org, NCBI)
Gene Name
HSPA1A
Full Name
Heat shock 70 kDa protein 1A
Weight
70.052kDa
Superfamily
heat shock protein 70 family
Alternative Names
Heat shock 70 kDa protein 1A; Heat shock 70 kDa protein 1B HSPA1A HEL-S-103, HSP70-1, HSP70-1A, HSP70-2, HSP70.1, HSP70.2, HSP70I, HSP72, HSPA1 heat shock protein family A (Hsp70) member 1A heat shock 70 kDa protein 1A|HSP70-1/HSP70-2|HSP70.1/HSP70.2|Heat shock 70 kDa protein 1B|Heat shock 70 kDa protein 2|dnaK-type molecular chaperone HSP70-1|epididymis secretory protein Li 103|epididymis secretory sperm binding protein|heat shock 70 kDa protein 1|heat shock 70 kDa protein 1/2|heat shock 70 kDa protein 1A/1B|heat shock 70kD protein 1A|heat shock 70kDa protein 1A|heat shock-induced protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HSPA1A, check out the HSPA1A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HSPA1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5) (M00949-Dyl550)
Hello CJ!
No publications found for M00949-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human Hsp70 DyLight® 550 conjugated HSPA1A Antibody(monoclonal, 3H5)
Question
I was wanting to use your anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) for Flow Cytometry for human colon carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human colon carcinoma identification?
Verified Customer
Verified customer
Asked: 2020-04-16
Answer
As indicated on the product datasheet, M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) has been validated for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human colon carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-04-16
Question
Our lab were content with the WB result of your anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5). However we have seen positive staining in uterus cytoplasm. using this antibody. Is that expected? Could you tell me where is HSPA1A supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-03-19
Answer
Based on literature, uterus does express HSPA1A. Generally HSPA1A expresses in cytoplasm. Regarding which tissues have HSPA1A expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 23349634
Brain, Muscle, Pancreas, PNS, and Skin, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-03-19
Question
Please see the WB image, lot number and protocol we used for colon carcinoma using anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-11-18
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-18
Question
Does M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-07-24
Answer
It shows on the product datasheet, M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-24
Question
I have a question about product M00949-Dyl550, anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-24
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-24
Question
Is a blocking peptide available for product anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) (M00949-Dyl550)?
Verified Customer
Verified customer
Asked: 2019-07-23
Answer
We do provide the blocking peptide for product anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) (M00949-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-07-23
Question
I see that the anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
M. Li
Verified customer
Asked: 2019-03-20
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-03-20
Question
Will anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 work for Flow Cytometry with colon carcinoma?
S. Dhar
Verified customer
Asked: 2018-12-27
Answer
According to the expression profile of colon carcinoma, HSPA1A is highly expressed in colon carcinoma. So, it is likely that anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 will work for Flow Cytometry with colon carcinoma.
Boster Scientific Support
Answered: 2018-12-27
Question
We have observed staining in human liver. Any tips? Is anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) supposed to stain liver positively?
Verified Customer
Verified customer
Asked: 2018-11-30
Answer
From what I have seen in literature liver does express HSPA1A. From what I have seen in Uniprot.org, HSPA1A is expressed in endothelial cell, uterus, brain, muscle, pancreas, pns skin, embryonic kidney, brain, cajal-retzius cell fetal brain cortex, cervix carcinoma, cervix carcinoma erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have HSPA1A expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 23349634
Brain, Muscle, Pancreas, PNS, and Skin, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2018-11-30
Question
Is this M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) reactive to the isotypes of HSPA1A?
Verified Customer
Verified customer
Asked: 2018-10-23
Answer
The immunogen of M00949-Dyl550 anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) is A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-10-23
Question
Is there a BSA free version of anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 available?
Verified Customer
Verified customer
Asked: 2018-03-23
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-03-23
Question
We are currently using anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2018-02-01
Answer
The anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) (M00949-Dyl550) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-02-01
Question
We are interested in to test anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 on human colon carcinoma for research purposes, then I may be interested in using anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
A. Anderson
Verified customer
Asked: 2014-12-30
Answer
The products we sell, including anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2014-12-30
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon carcinoma using anti-Human Hsp70 DyLight® 550 conjugated antibody(monoclonal, 3H5) M00949-Dyl550. Let me know if you need anything else.
G. Evans
Verified customer
Asked: 2013-09-03
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-09-03