Click image to see more details
Product Info Summary
| SKU: | A01801-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HTRA1 Antibody Picoband®
View all HTRA1/PRSS11 Antibodies
SKU/Catalog Number
A01801-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HTRA1 Antibody Picoband® catalog # A01801-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HTRA1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01801-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HTRA1, which shares 93.2% amino acid (aa) sequence identity with both mouse and rat HTRA1.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01801-1 is reactive to HTRA1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
51 kDa
Calculated molecular weight
51.287kDa
Background of HTRA1/PRSS11
Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01801-1 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Positive Control
WB: human MCF-7 whole cell, rat heart tissue, mouse heart tissue
IHC: human rectal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HTRA1 using anti-HTRA1 antibody (A01801-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human MCF-7 whole cell lysates,
Lane 2: rat heart tissue lysates,
Lane 3: mouse heart tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HTRA1 antigen affinity purified polyclonal antibody (Catalog # A01801-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HTRA1 at approximately 51KD. The expected band size for HTRA1 is at 51KD.
Click image to see more details
Figure 2. IHC analysis of HTRA1 using anti-HTRA1 antibody (A01801-1).
HTRA1 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-HTRA1 Antibody (A01801-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For HTRA1 (Source: Uniprot.org, NCBI)
Gene Name
HTRA1
Full Name
Serine protease HTRA1
Weight
51.287kDa
Superfamily
peptidase S1C family
Alternative Names
Serine protease HTRA1; High-temperature requirement A serine peptidase 1; L56; Serine protease 11; HTRA1; HTRA; PRSS11 HTRA1 ARMD7, CADASIL2, CARASIL, HtrA, L56, ORF480, PRSS11 HtrA serine peptidase 1 serine protease HTRA1|IGFBP5-protease|high-temperature requirement A serine peptidase 1|protease, serine, 11 (IGF binding)
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HTRA1, check out the HTRA1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HTRA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HTRA1 Antibody Picoband® (A01801-1)
Hello CJ!
No publications found for A01801-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HTRA1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-HTRA1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-HTRA1 Antibody Picoband®
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-HTRA1 antibody A01801-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-04-16
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-16
Question
We are currently using anti-HTRA1 antibody A01801-1 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-27
Answer
The anti-HTRA1 antibody (A01801-1) has not been validated for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-27
Question
Is this A01801-1 anti-HTRA1 antibody reactive to the isotypes of HTRA1?
E. Zhang
Verified customer
Asked: 2019-11-11
Answer
The immunogen of A01801-1 anti-HTRA1 antibody is A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-11
Question
I was wanting to use your anti-HTRA1 antibody for WB for rat placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat placenta identification?
Verified Customer
Verified customer
Asked: 2019-09-25
Answer
It shows on the product datasheet, A01801-1 anti-HTRA1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat placenta in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-25
Question
My question regarding product A01801-1, anti-HTRA1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
B. Miller
Verified customer
Asked: 2018-12-31
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01801-1 anti-HTRA1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-12-31
