Product Info Summary
SKU: | PB9640 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GRP78 BiP/HSPA5 Antibody Picoband™
View all GRP78/HSPA5 Antibodies
SKU/Catalog Number
PB9640
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GRP78 BiP/HSPA5 Antibody Picoband™ catalog # PB9640. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GRP78 BiP/HSPA5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9640)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9640 is reactive to HSPA5 in Human, Mouse, Rat
Applications
PB9640 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
72 kDa
Calculated molecular weight
72333 MW
Background of GRP78/HSPA5
HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat, By Heat
Validation Images & Assay Conditions
![pb9640 gip primary antibodies wb testing 1 pb9640 gip primary antibodies wb testing 1](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-wb-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of GIP using anti-GIP antibody (PB9640).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human PC-3 whole cell lysates,
Lane 2: human MCF-7 whole cell lysates,
Lane 3: human Hela whole cell lysates,
Lane 4: human HepG2 whole cell lysates,
Lane 5: human U87 whole cell lysates,
Lane 6: human Hacat whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GIP antigen affinity purified polyclonal antibody (Catalog # PB9640) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GIP at approximately 72 kDa. The expected band size for GIP is at 72 kDa.
![pb9640 gip primary antibodies ihc testing 2 pb9640 gip primary antibodies ihc testing 2](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-ihc-testing-2.jpg)
Click image to see more details
Figure 2. IHC analysis of GIP using anti-GIP antibody (PB9640).
GIP was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-GIP Antibody (PB9640) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
![pb9640 gip primary antibodies ihc testing 3 pb9640 gip primary antibodies ihc testing 3](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-ihc-testing-3.jpg)
Click image to see more details
Figure 3. IHC analysis of GIP using anti-GIP antibody (PB9640).
GIP was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-GIP Antibody (PB9640) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
![pb9640 gip primary antibodies ihc testing 4 pb9640 gip primary antibodies ihc testing 4](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-ihc-testing-4.jpg)
Click image to see more details
Figure 4. IHC analysis of GIP using anti-GIP antibody (PB9640).
GIP was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-GIP Antibody (PB9640) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
![pb9640 gip primary antibodies ihc testing 5 pb9640 gip primary antibodies ihc testing 5](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-ihc-testing-5.jpg)
Click image to see more details
Figure 5. IHC analysis of GIP using anti-GIP antibody (PB9640).
GIP was detected in a paraffin-embedded section of rat colon tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-GIP Antibody (PB9640) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
![pb9640 gip primary antibodies ihc testing 6 pb9640 gip primary antibodies ihc testing 6](https://www.bosterbio.com/media/catalog/product/p/b/pb9640-gip-primary-antibodies-ihc-testing-6.jpg)
Click image to see more details
Figure 6. IHC analysis of GIP using anti-GIP antibody (PB9640).
GIP was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-GIP Antibody (PB9640) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For HSPA5 (Source: Uniprot.org, NCBI)
Gene Name
HSPA5
Full Name
Endoplasmic reticulum chaperone BiP
Weight
72333 MW
Superfamily
heat shock protein 70 family
Alternative Names
78 kDa glucose-regulated protein; BIP; Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; FLJ26106; GRP78; GRP-78; GRP78BIP; Heat shock 70 kDa protein 5; heat shock 70kD protein 5 (glucose-regulated protein, 78kD); heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa); HSP70-5; HSPA5; Immunoglobulin heavy chain-binding protein; MIF2 HSPA5 BIP, GRP78, HEL-S-89n heat shock protein family A (Hsp70) member 5 endoplasmic reticulum chaperone BiP|78 kDa glucose-regulated protein|HSP70 family protein 5|binding-immunoglobulin protein|endoplasmic reticulum lumenal Ca(2+)-binding protein grp78|epididymis secretory sperm binding protein Li 89n|glucose-regulated protein, 78kDa|heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)|heat shock protein 70 family protein 5|heat shock protein family A member 5|immunoglobulin heavy chain-binding protein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HSPA5, check out the HSPA5 Infographic
![HSPA5 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HSPA5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GRP78 BiP/HSPA5 Antibody Picoband™ (PB9640)
Hello CJ!
PB9640 has been cited in 8 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Chi L,Jiao D,Nan G,Yuan H,Shen J,Gao Y.miR-9-5p attenuates ischemic stroke through targeting ERMP1-mediated endoplasmic reticulum stress.Acta Histochem.2019 Nov;121(8):151438.doi:10.1016/j.acthis.2019.08.005.Epub 2019 Sep 7.PMID:31500865.
Species: Human,Rat
PB9640 usage in article: APP:WB, SAMPLE:ISCHEMIC PENUMBRA PART AND SH-SY5Y CELL, DILUTION:NA
Huang Y,Zhao C,Kong Y,Tan P,Liu S,Liu Y,Zeng F,Yuan Y,Zhao B,Wang J.Elucidation of the mechanism of NEFA-induced PERK-eIF2α signaling pathway regulation of lipid metabolism in bovine hepatocytes.J Steroid Biochem Mol Biol.2021 Apr 2:105893.doi:10.101 6/j.jsbmb.2021.105893.Epub ahead of print.PMID:33819629.
Species: Holstein calves
PB9640 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:1:1000
Pei-pei Fang,Chen-wei Pan,Wei Lin,Jie Li,Shan-shan Huang,Guang-yao Zhou,Wen-jun Du,Qiang Li, "ASK1 Enhances Angiotensin II-Induced Liver Fibrosis In Vitro by Mediating Endoplasmic Reticulum Stress-Dependent Exosomes",Mediators of Inflammation,vol.2020,Art
Species: Human
PB9640 usage in article: APP:WB, SAMPLE:LX-2 CELLS, DILUTION:1:1200
Catalpol Inhibits Homocysteine-induced Oxidation and Inflammation via Inhibiting Nox4/NF-κB and GRP78/PERK Pathways in Human Aorta Endothelial Cells Huimin Hu 1, Changyuan Wang 1, Yue Jin 1, Qiang Meng 1, Qi Liu 1, Zhihao Liu 1, Kexin Liu 1, Xiaoyu Liu
Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways
Ulinastatin suppresses endoplasmic reticulum stress and apoptosis in the hippocampus of rats with acute paraquat poisoning
Ding Y, Zou J, Li Z, Tian J, Abdelalim S, Du F, She R, Wang D, Tan C, Wang H, Chen W, Lv D, Chang L. Plos One. 2011;6(5):E20008. Doi: 10.1371/Journal.Pone.0020008. Epub 2011 May 23. Study Of Histopathological And Molecular Changes Of Rat Kidney Un...
Wu C, Dong S, Li Y. Int J Mol Med. 2015 Apr;35(4):893-900. Doi: 10.3892/Ijmm.2015.2105. Epub 2015 Feb 18. Effects Of Mirna-455 On Cardiac Hypertrophy Induced By Pressure Overload.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GRP78 BiP/HSPA5 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-GRP78 BiP/HSPA5 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-GRP78 BiP/HSPA5 Antibody Picoband™
Question
My lab would like to test anti-GRP78 BiP/HSPA5 antibody PB9640 on mouse mammary carcinoma for research purposes, then I may be interested in using anti-GRP78 BiP/HSPA5 antibody PB9640 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-04-28
Answer
The products we sell, including anti-GRP78 BiP/HSPA5 antibody PB9640, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-04-28
Question
Is this PB9640 anti-GRP78 BiP/HSPA5 antibody reactive to the isotypes of HSPA5?
Verified Customer
Verified customer
Asked: 2020-04-10
Answer
The immunogen of PB9640 anti-GRP78 BiP/HSPA5 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-10
Question
My question regarding product PB9640, anti-GRP78 BiP/HSPA5 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-02-11
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9640 anti-GRP78 BiP/HSPA5 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-02-11
Question
Is a blocking peptide available for product anti-GRP78 BiP/HSPA5 antibody (PB9640)?
R. Gonzalez
Verified customer
Asked: 2019-12-11
Answer
We do provide the blocking peptide for product anti-GRP78 BiP/HSPA5 antibody (PB9640). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for mammary carcinoma using anti-GRP78 BiP/HSPA5 antibody PB9640. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-25
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-25
Question
Will PB9640 anti-GRP78 BiP/HSPA5 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-07-23
Answer
It shows on the product datasheet, PB9640 anti-GRP78 BiP/HSPA5 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-07-23
Question
Is there a BSA free version of anti-GRP78 BiP/HSPA5 antibody PB9640 available?
Verified Customer
Verified customer
Asked: 2019-07-15
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GRP78 BiP/HSPA5 antibody PB9640 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-07-15
Question
We were well pleased with the WB result of your anti-GRP78 BiP/HSPA5 antibody. However we have observed positive staining in colon carcinoma endoplasmic reticulum lumen using this antibody. Is that expected? Could you tell me where is HSPA5 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-06-26
Answer
From literature, colon carcinoma does express HSPA5. Generally HSPA5 expresses in endoplasmic reticulum lumen. Regarding which tissues have HSPA5 expression, here are a few articles citing expression in various tissues:
Articular cartilage, Pubmed ID: 11160188
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 1550958
Cervix carcinoma, Pubmed ID: 20068231
Colon carcinoma, Pubmed ID: 9150948, 24129315
Fibroblast, Pubmed ID: 15164053
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Melanoma, Pubmed ID: 12643545, 17081065
Muscle, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-06-26
Question
We have been able to see staining in human melanoma. Are there any suggestions? Is anti-GRP78 BiP/HSPA5 antibody supposed to stain melanoma positively?
Verified Customer
Verified customer
Asked: 2018-09-21
Answer
From literature melanoma does express HSPA5. From Uniprot.org, HSPA5 is expressed in vena cava, cervix carcinoma, fibroblast, muscle, articular cartilage, mammary carcinoma, colon carcinoma, brain, cajal-retzius cell fetal brain cortex, melanoma, liver, among other tissues. Regarding which tissues have HSPA5 expression, here are a few articles citing expression in various tissues:
Articular cartilage, Pubmed ID: 11160188
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 1550958
Cervix carcinoma, Pubmed ID: 20068231
Colon carcinoma, Pubmed ID: 9150948, 24129315
Fibroblast, Pubmed ID: 15164053
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 9150946
Melanoma, Pubmed ID: 12643545, 17081065
Muscle, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2018-09-21
Question
I am looking for using your anti-GRP78 BiP/HSPA5 antibody for ire1alpha activates chaperones studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-07-12
Answer
I appreciate your inquiry. This PB9640 anti-GRP78 BiP/HSPA5 antibody is validated on hela whole cell lysate, mouse brain, testis tissue, brain tissue, rat testis tissue, lung cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-07-12
Question
I have attached the WB image, lot number and protocol we used for mammary carcinoma using anti-GRP78 BiP/HSPA5 antibody PB9640. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-05-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-05-30
Question
We are currently using anti-GRP78 BiP/HSPA5 antibody PB9640 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Verified customer
Asked: 2017-09-07
Answer
The anti-GRP78 BiP/HSPA5 antibody (PB9640) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-09-07
Question
We ordered your anti-GRP78 BiP/HSPA5 antibody for IHC on melanoma in the past. I am using rat, and We are going to use the antibody for WB next. I am interested in examining melanoma as well as cajal-retzius cell fetal brain cortex in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
K. Krishna
Verified customer
Asked: 2015-06-03
Answer
I took a look at the website and datasheets of our anti-GRP78 BiP/HSPA5 antibody and it seems that PB9640 has been tested on rat in both IHC and WB. Thus PB9640 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2015-06-03
Question
I was wanting to use your anti-GRP78 BiP/HSPA5 antibody for WB for mouse mammary carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse mammary carcinoma identification?
J. Moore
Verified customer
Asked: 2015-05-04
Answer
It shows on the product datasheet, PB9640 anti-GRP78 BiP/HSPA5 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse mammary carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-05-04
Question
I see that the anti-GRP78 BiP/HSPA5 antibody PB9640 works with WB, what is the protocol used to produce the result images on the product page?
P. Huang
Verified customer
Asked: 2014-04-09
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-04-09
Question
Does anti-GRP78 BiP/HSPA5 antibody PB9640 work for WB with mammary carcinoma?
V. Lewis
Verified customer
Asked: 2013-09-13
Answer
According to the expression profile of mammary carcinoma, HSPA5 is highly expressed in mammary carcinoma. So, it is likely that anti-GRP78 BiP/HSPA5 antibody PB9640 will work for WB with mammary carcinoma.
Boster Scientific Support
Answered: 2013-09-13