Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™

Glucose 6 phosphate isomerase antibody

Boster Bio Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™ catalog # PB10069. Tested in WB applications. This antibody reacts with Mouse.

Product Info Summary

SKU: PB10069
Size: 100 μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: WB

Product Name

Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™

View all Glucose 6 phosphate isomerase Antibodies

SKU/Catalog Number

PB10069

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™ catalog # PB10069. Tested in WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10069)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI, different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10069 is reactive to GPI in Mouse

Applications

PB10069 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

64 kDa

Calculated molecular weight

62767 MW

Background of Glucose 6 phosphate isomerase

Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase (PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For GPI (Source: Uniprot.org, NCBI)

Gene Name

GPI

Full Name

Glucose-6-phosphate isomerase

Weight

62767 MW

Superfamily

GPI family

Alternative Names

AMFGNPI; Autocrine motility factor; DKFZp686C13233; EC 5.3.1.9; glucose phosphate isomerase; glucose-6-phosphate isomerase; hexose monophosphate isomerase; hexosephosphate isomerase; neuroleukin; NLKSA36; oxoisomerase; PGI; PHI; Phosphoglucose isomerase; phosphohexomutase; Phosphohexose isomerase; phosphosaccharomutase; SA-36; Sperm antigen 36; sperm antigen-36 GPI AMF, GNPI, NLK, PGI, PHI, SA-36, SA36 glucose-6-phosphate isomerase glucose-6-phosphate isomerase|autocrine motility factor|hexose monophosphate isomerase|hexosephosphate isomerase|neuroleukin|oxoisomerase|phosphoglucose isomerase|phosphohexomutase|phosphohexose isomerase|phosphosaccharomutase|sperm antigen-36

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GPI, check out the GPI Infographic

GPI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GPI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10069

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Glucose 6 phosphate isomerase/GPI Antibody Picoband™

Question

We are currently using anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-21

Answer

The anti-Glucose 6 phosphate isomerase/GPI antibody (PB10069) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-21

Question

We have been able to see staining in mouse cervix carcinoma. Are there any suggestions? Is anti-Glucose 6 phosphate isomerase/GPI antibody supposed to stain cervix carcinoma positively?

Verified Customer

Verified customer

Asked: 2019-07-08

Answer

Based on literature cervix carcinoma does express GPI. Based on Uniprot.org, GPI is expressed in cerebellar vermis, testis, amygdala, skin, b-cell lymphoma, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have GPI expression, here are a few articles citing expression in various tissues:
Amygdala, Pubmed ID: 14702039
B-cell lymphoma, Pubmed ID: 3352745
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Skin, Pubmed ID: 15489334
Testis, Pubmed ID: 10727272

Boster Scientific Support

Answered: 2019-07-08

Question

Our team were content with the WB result of your anti-Glucose 6 phosphate isomerase/GPI antibody. However we have seen positive staining in b-cell lymphoma cytoplasm. using this antibody. Is that expected? Could you tell me where is GPI supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-07-03

Answer

According to literature, b-cell lymphoma does express GPI. Generally GPI expresses in cytoplasm. Regarding which tissues have GPI expression, here are a few articles citing expression in various tissues:
Amygdala, Pubmed ID: 14702039
B-cell lymphoma, Pubmed ID: 3352745
Cervix carcinoma, Pubmed ID: 18669648
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 24275569
Skin, Pubmed ID: 15489334
Testis, Pubmed ID: 10727272

Boster Scientific Support

Answered: 2019-07-03

Question

Is there a BSA free version of anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 available?

Verified Customer

Verified customer

Asked: 2019-05-15

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-05-15

Question

My question regarding product PB10069, anti-Glucose 6 phosphate isomerase/GPI antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-02-07

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-02-07

Question

I was wanting to use your anti-Glucose 6 phosphate isomerase/GPI antibody for WB for mouse skin on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse skin identification?

Verified Customer

Verified customer

Asked: 2019-01-17

Answer

As indicated on the product datasheet, PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody has been tested for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse skin in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-01-17

Question

Does anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 work for WB with skin?

J. Zhao

Verified customer

Asked: 2018-09-06

Answer

According to the expression profile of skin, GPI is highly expressed in skin. So, it is likely that anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 will work for WB with skin.

Boster Scientific Support

Answered: 2018-09-06

Question

I would like to test anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 on mouse skin for research purposes, then I may be interested in using anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

N. Williams

Verified customer

Asked: 2018-06-29

Answer

The products we sell, including anti-Glucose 6 phosphate isomerase/GPI antibody PB10069, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-06-29

Question

Does PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

R. Krishna

Verified customer

Asked: 2018-06-08

Answer

As indicated on the product datasheet, PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-06-08

Question

Is this PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody reactive to the isotypes of GPI?

Verified Customer

Verified customer

Asked: 2017-11-02

Answer

The immunogen of PB10069 anti-Glucose 6 phosphate isomerase/GPI antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-11-02

Question

I have attached the WB image, lot number and protocol we used for skin using anti-Glucose 6 phosphate isomerase/GPI antibody PB10069. Please let me know if you require anything else.

M. Taylor

Verified customer

Asked: 2016-06-13

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-13

Question

I see that the anti-Glucose 6 phosphate isomerase/GPI antibody PB10069 works with WB, what is the protocol used to produce the result images on the product page?

O. Jones

Verified customer

Asked: 2015-03-12

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2015-03-12

Question

Is a blocking peptide available for product anti-Glucose 6 phosphate isomerase/GPI antibody (PB10069)?

M. Huang

Verified customer

Asked: 2013-10-29

Answer

We do provide the blocking peptide for product anti-Glucose 6 phosphate isomerase/GPI antibody (PB10069). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-10-29

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for skin using anti-Glucose 6 phosphate isomerase/GPI antibody PB10069. Let me know if you need anything else.

S. Wu

Verified customer

Asked: 2013-02-06

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-02-06

Order DetailsPrice
PB10069

100μg

$370
PB10069-10ug

10μg sample (liquid)

$99
PB10069-Biotin

100 μg Biotin conjugated

$570
PB10069-Cy3

100 μg Cy3 conjugated

$570
PB10069-Dylight488

100 μg Dylight488 conjugated

$570
PB10069-Dylight550

100 μg Dylight550 conjugated

$570
PB10069-Dylight594

100 μg Dylight594 conjugated

$570
PB10069-FITC

100 μg FITC conjugated

$570
PB10069-HRP

100 μg HRP conjugated

$570
PB10069-APC

100 μg APC conjugated

$670
PB10069-PE

100 μg PE conjugated

$670
PB10069-iFluor647

100 μg iFluor647 conjugated

$670
PB10069-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10069
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.