Product Info Summary
SKU: | A04680-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-FZD3 Antibody Picoband™
View all Frizzled-3 Antibodies
SKU/Catalog Number
A04680-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-FZD3 Antibody Picoband™ catalog # A04680-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-FZD3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04680-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FZD3, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04680-1 is reactive to FZD3 in Human, Mouse, Rat
Applications
A04680-1 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
76 kDa
Calculated molecular weight
Background of Frizzled-3
Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Validation Images & Assay Conditions
![A04680 1 FZD3 primary antibodies WB testing 1 A04680 1 FZD3 primary antibodies WB testing 1](https://www.bosterbio.com/media/catalog/product/A/0/A04680-1-FZD3-primary-antibodies-WB-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of FZD3 using anti-FZD3 antibody (A04680-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human SK-OV-3 cell lysates,
Lane 2: human Jurkat cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FZD3 antigen affinity purified polyclonal antibody (Catalog # A04680-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for FZD3 at approximately 76KD. The expected band size for FZD3 is at 76KD.
![A04680 1 FZD3 primary antibodies IHC testing 2 A04680 1 FZD3 primary antibodies IHC testing 2](https://www.bosterbio.com/media/catalog/product/A/0/A04680-1-FZD3-primary-antibodies-IHC-testing-2.jpg)
Click image to see more details
Figure 2. IHC analysis of FZD3 using anti-FZD3 antibody (A04680-1).
FZD3 was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-FZD3 Antibody (A04680-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![A04680 1 FZD3 primary antibodies IHC testing 3 A04680 1 FZD3 primary antibodies IHC testing 3](https://www.bosterbio.com/media/catalog/product/A/0/A04680-1-FZD3-primary-antibodies-IHC-testing-3.jpg)
Click image to see more details
Figure 3. IHC analysis of FZD3 using anti-FZD3 antibody (A04680-1).
FZD3 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-FZD3 Antibody (A04680-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![A04680 1 FZD3 primary antibodies IHC testing 4 A04680 1 FZD3 primary antibodies IHC testing 4](https://www.bosterbio.com/media/catalog/product/A/0/A04680-1-FZD3-primary-antibodies-IHC-testing-4.jpg)
Click image to see more details
Figure 4. IHC analysis of FZD3 using anti-FZD3 antibody (A04680-1).
FZD3 was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-FZD3 Antibody (A04680-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
![A04680 1 FZD3 primary antibodies IHC testing 5 A04680 1 FZD3 primary antibodies IHC testing 5](https://www.bosterbio.com/media/catalog/product/A/0/A04680-1-FZD3-primary-antibodies-IHC-testing-5.jpg)
Click image to see more details
Figure 5. IHC analysis of FZD3 using anti-FZD3 antibody (A04680-1).
FZD3 was detected in paraffin-embedded section of rat kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-FZD3 Antibody (A04680-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For FZD3 (Source: Uniprot.org, NCBI)
Gene Name
FZD3
Full Name
Frizzled-3
Weight
Superfamily
G-protein coupled receptor Fz/Smo family
Alternative Names
frizzled (Drosophila) homolog 3; frizzled homolog 3 (Drosophila); Frizzled3; Frizzled-3; Fz-3; FZD3; hFz3 FZD3 Fz-3 frizzled class receptor 3 frizzled-3|frizzled 3, seven transmembrane spanning receptor|frizzled family receptor 3|frizzled homolog 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FZD3, check out the FZD3 Infographic
![FZD3 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FZD3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-FZD3 Antibody Picoband™ (A04680-1)
Hello CJ!
No publications found for A04680-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-FZD3 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-FZD3 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
13 Customer Q&As for Anti-FZD3 Antibody Picoband™
Question
Will anti-FZD3 antibody A04680-1 work for WB with keratinocyte?
Verified Customer
Verified customer
Asked: 2020-05-07
Answer
According to the expression profile of keratinocyte, FZD3 is highly expressed in keratinocyte. So, it is likely that anti-FZD3 antibody A04680-1 will work for WB with keratinocyte.
Boster Scientific Support
Answered: 2020-05-07
Question
Is this A04680-1 anti-FZD3 antibody reactive to the isotypes of FZD3?
G. Anderson
Verified customer
Asked: 2020-02-21
Answer
The immunogen of A04680-1 anti-FZD3 antibody is A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-02-21
Question
See below the WB image, lot number and protocol we used for keratinocyte using anti-FZD3 antibody A04680-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-12-16
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-12-16
Question
I see that the anti-FZD3 antibody A04680-1 works with WB, what is the protocol used to produce the result images on the product page?
H. Moore
Verified customer
Asked: 2019-12-03
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-12-03
Question
I was wanting to use your anti-FZD3 antibody for WB for rat keratinocyte on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat keratinocyte identification?
Verified Customer
Verified customer
Asked: 2019-11-15
Answer
It shows on the product datasheet, A04680-1 anti-FZD3 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat keratinocyte in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-11-15
Question
Would A04680-1 anti-FZD3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
A. Williams
Verified customer
Asked: 2019-11-14
Answer
You can see on the product datasheet, A04680-1 anti-FZD3 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-11-14
Question
My question regarding product A04680-1, anti-FZD3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
J. Banerjee
Verified customer
Asked: 2018-09-27
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04680-1 anti-FZD3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-09-27
Question
Our lab want to know about to test anti-FZD3 antibody A04680-1 on rat keratinocyte for research purposes, then I may be interested in using anti-FZD3 antibody A04680-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-06-28
Answer
The products we sell, including anti-FZD3 antibody A04680-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-06-28
Question
Is a blocking peptide available for product anti-FZD3 antibody (A04680-1)?
J. Johnson
Verified customer
Asked: 2018-03-13
Answer
We do provide the blocking peptide for product anti-FZD3 antibody (A04680-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-03-13
Question
Do you have a BSA free version of anti-FZD3 antibody A04680-1 available?
Verified Customer
Verified customer
Asked: 2017-11-14
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-FZD3 antibody A04680-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-11-14
Question
We are currently using anti-FZD3 antibody A04680-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
N. Mangal
Verified customer
Asked: 2017-04-20
Answer
The anti-FZD3 antibody (A04680-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-04-20
Question
Does anti-FZD3 antibody A04680-1 work on bovine WB with brain?
R. Krishna
Verified customer
Asked: 2014-11-24
Answer
Our lab technicians have not tested anti-FZD3 antibody A04680-1 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-FZD3 antibody A04680-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-11-24
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for keratinocyte using anti-FZD3 antibody A04680-1. Let me know if you need anything else.
R. Edwards
Verified customer
Asked: 2013-02-22
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2013-02-22