Anti-Frizzled 4/FZD4 Antibody Picoband®

Frizzled-4 antibody

Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A02191-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Frizzled 4/FZD4 Antibody Picoband®

View all Frizzled-4 Antibodies

SKU/Catalog Number

A02191-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Frizzled 4/FZD4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02191-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Frizzled 4, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02191-1 is reactive to FZD4 in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

65 kDa

Calculated molecular weight

31568 MW

Background of Frizzled-4

Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A02191-1 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Positive Control

WB: human placenta tissue, human MCF-7 cell
IHC: human lung cancer tissue, human mammary cancer tissue, mouse heart tissue, rat heart tissue

Validation Images & Assay Conditions

Gene/Protein Information For FZD4 (Source: Uniprot.org, NCBI)

Gene Name

FZD4

Full Name

Frizzled-4

Weight

31568 MW

Superfamily

G-protein coupled receptor Fz/Smo family

Alternative Names

Frizzled-4; Fz-4; hFz4; FzE4; CD344; FZD4 FZD4 CD344, EVR1, FEVRS, Fz-4, Fz4, FzE4, GPCR, hFz4, FZD4 frizzled class receptor 4 frizzled-4|WNT receptor frizzled-4|frizzled 4, seven transmembrane spanning receptor|frizzled family receptor 4|frizzled homolog 4

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on FZD4, check out the FZD4 Infographic

FZD4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FZD4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A02191-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Li X,Lv J,Hou L,Guo X. Circ_0001955 Acts as a miR-646 Sponge to Promote the Proliferation, Metastasis and Angiogenesis of Hepatocellular Carcinoma.Dig Dis Sci.2021 May 22.doi:10.1007/s10620-021-07053-8.Epub ahead of print.PMID:34021822.
Species: Human,Mouse
A02191-1 usage in article: APP:IHC, SAMPLE: TUMOR TISSUE, DILUTION:1:200

Have you used Anti-Frizzled 4/FZD4 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Frizzled 4/FZD4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Frizzled 4/FZD4 Antibody Picoband®

Question

We are currently using anti-Frizzled 4/FZD4 antibody A02191-1 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The anti-Frizzled 4/FZD4 antibody (A02191-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-01

Question

I see that the anti-Frizzled 4/FZD4 antibody A02191-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-12-02

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-12-02

Question

Does anti-Frizzled 4/FZD4 antibody A02191-1 work for WB with adipose tissue of abdominal region?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

According to the expression profile of adipose tissue of abdominal region, FZD4 is highly expressed in adipose tissue of abdominal region. So, it is likely that anti-Frizzled 4/FZD4 antibody A02191-1 will work for WB with adipose tissue of abdominal region.

Boster Scientific Support

Answered: 2019-09-02

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adipose tissue of abdominal region using anti-Frizzled 4/FZD4 antibody A02191-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-12-11

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-12-11

Question

I was wanting to use your anti-Frizzled 4/FZD4 antibody for WB for mouse adipose tissue of abdominal region on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse adipose tissue of abdominal region identification?

J. Miller

Verified customer

Asked: 2017-09-06

Answer

You can see on the product datasheet, A02191-1 anti-Frizzled 4/FZD4 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse adipose tissue of abdominal region in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-06

Question

My lab would like to test anti-Frizzled 4/FZD4 antibody A02191-1 on mouse adipose tissue of abdominal region for research purposes, then I may be interested in using anti-Frizzled 4/FZD4 antibody A02191-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-06-06

Answer

The products we sell, including anti-Frizzled 4/FZD4 antibody A02191-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-06-06

Question

Is this A02191-1 anti-Frizzled 4/FZD4 antibody reactive to the isotypes of FZD4?

C. Zhang

Verified customer

Asked: 2013-04-22

Answer

The immunogen of A02191-1 anti-Frizzled 4/FZD4 antibody is A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-04-22

Order DetailsPrice
A02191-1

100μg

$370
A02191-1-10ug

10μg sample (liquid)

$99
A02191-1-Biotin

100 μg Biotin conjugated

$570
A02191-1-Cy3

100 μg Cy3 conjugated

$570
A02191-1-Dylight488

100 μg Dylight488 conjugated

$570
A02191-1-Dylight550

100 μg Dylight550 conjugated

$570
A02191-1-Dylight594

100 μg Dylight594 conjugated

$570
A02191-1-FITC

100 μg FITC conjugated

$570
A02191-1-HRP

100 μg HRP conjugated

$570
A02191-1-APC

100 μg APC conjugated

$670
A02191-1-PE

100 μg PE conjugated

$670
A02191-1-iFluor647

100 μg iFluor647 conjugated

$670
A02191-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02191-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.