Product Info Summary
SKU: | A02191-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Frizzled 4/FZD4 Antibody Picoband®
View all Frizzled-4 Antibodies
SKU/Catalog Number
A02191-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Frizzled 4/FZD4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02191-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Frizzled 4, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02191-1 is reactive to FZD4 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
65 kDa
Calculated molecular weight
31568 MW
Background of Frizzled-4
Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A02191-1 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Positive Control
WB: human placenta tissue, human MCF-7 cell
IHC: human lung cancer tissue, human mammary cancer tissue, mouse heart tissue, rat heart tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates,
Lane 2: human MCF-7 cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Frizzled 4 antigen affinity purified polyclonal antibody (Catalog # A02191-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Frizzled 4 at approximately 65KD. The expected band size for Frizzled 4 is at 60KD.
Click image to see more details
Figure 2. IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1). Frizzled 4 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Frizzled 4 Antibody (A02191-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1). Frizzled 4 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Frizzled 4 Antibody (A02191-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1).
Frizzled 4 was detected in paraffin-embedded section of mouse heart tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Frizzled 4 Antibody (A02191-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1).
Frizzled 4 was detected in paraffin-embedded section of rat heart tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-Frizzled 4 Antibody (A02191-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For FZD4 (Source: Uniprot.org, NCBI)
Gene Name
FZD4
Full Name
Frizzled-4
Weight
31568 MW
Superfamily
G-protein coupled receptor Fz/Smo family
Alternative Names
Frizzled-4; Fz-4; hFz4; FzE4; CD344; FZD4 FZD4 CD344, EVR1, FEVRS, Fz-4, Fz4, FzE4, GPCR, hFz4, FZD4 frizzled class receptor 4 frizzled-4|WNT receptor frizzled-4|frizzled 4, seven transmembrane spanning receptor|frizzled family receptor 4|frizzled homolog 4
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on FZD4, check out the FZD4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for FZD4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Frizzled 4/FZD4 Antibody Picoband® (A02191-1)
Hello CJ!
A02191-1 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Li X,Lv J,Hou L,Guo X. Circ_0001955 Acts as a miR-646 Sponge to Promote the Proliferation, Metastasis and Angiogenesis of Hepatocellular Carcinoma.Dig Dis Sci.2021 May 22.doi:10.1007/s10620-021-07053-8.Epub ahead of print.PMID:34021822.
Species: Human,Mouse
A02191-1 usage in article: APP:IHC, SAMPLE: TUMOR TISSUE, DILUTION:1:200
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Frizzled 4/FZD4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Frizzled 4/FZD4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Frizzled 4/FZD4 Antibody Picoband®
Question
We are currently using anti-Frizzled 4/FZD4 antibody A02191-1 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
The anti-Frizzled 4/FZD4 antibody (A02191-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-05-01
Question
I see that the anti-Frizzled 4/FZD4 antibody A02191-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-12-02
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-12-02
Question
Does anti-Frizzled 4/FZD4 antibody A02191-1 work for WB with adipose tissue of abdominal region?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
According to the expression profile of adipose tissue of abdominal region, FZD4 is highly expressed in adipose tissue of abdominal region. So, it is likely that anti-Frizzled 4/FZD4 antibody A02191-1 will work for WB with adipose tissue of abdominal region.
Boster Scientific Support
Answered: 2019-09-02
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adipose tissue of abdominal region using anti-Frizzled 4/FZD4 antibody A02191-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-12-11
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-12-11
Question
I was wanting to use your anti-Frizzled 4/FZD4 antibody for WB for mouse adipose tissue of abdominal region on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse adipose tissue of abdominal region identification?
J. Miller
Verified customer
Asked: 2017-09-06
Answer
You can see on the product datasheet, A02191-1 anti-Frizzled 4/FZD4 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse adipose tissue of abdominal region in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-09-06
Question
My lab would like to test anti-Frizzled 4/FZD4 antibody A02191-1 on mouse adipose tissue of abdominal region for research purposes, then I may be interested in using anti-Frizzled 4/FZD4 antibody A02191-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-06-06
Answer
The products we sell, including anti-Frizzled 4/FZD4 antibody A02191-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-06-06
Question
Is this A02191-1 anti-Frizzled 4/FZD4 antibody reactive to the isotypes of FZD4?
C. Zhang
Verified customer
Asked: 2013-04-22
Answer
The immunogen of A02191-1 anti-Frizzled 4/FZD4 antibody is A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-04-22