Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

Product Name

Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody

View all TMEM16A Antibodies

SKU/Catalog Number

M30940

Size

100ug/vial

Form

Liquid

Description

Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody (Catalog # M30940). Tested in IHC applications. This antibody reacts with Human.

Storage & Handling

Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Cite This Product

Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # M30940)

Host

Mouse

Contents

Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.

Clonality

Monoclonal

Clone Number

Clone: DG1/447 + DOG-1.1

Isotype

IgG1, kappa + IgG1, kappa

Immunogen

Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

Does not cross-react with primate, avian or amphibian GR.

Reactive Species

M30940 is reactive to TMEM16A in Human

Reconstitution

Reconstitute with distilled water.

Observed Molecular Weight

68 kDa

Calculated molecular weight

114078 MW

Background of TMEM16A

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST's), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST's, including all c-kit negative GIST's. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST's is nearly identical: 94.4% vs. 94.7%.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

M30940 is guaranteed for IHC Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)
Optimal dilution for a specific application should be determined.

Validation Images & Assay Conditions

Gene/Protein Information For TMEM16A (Source: Uniprot.org, NCBI)

Alternative Names

Anoctamin-1;Discovered on gastrointestinal stromal tumors protein 1;Oral cancer overexpressed protein 2;Transmembrane protein 16A;Tumor-amplified and overexpressed sequence 2;ANO1;DOG1, ORAOV2, TAOS2, TMEM16A;

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis