Click image to see more details
Product Info Summary
| SKU: | A00919-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SLC26A4 Antibody Picoband®
SKU/Catalog Number
A00919-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SLC26A4 Antibody Picoband® catalog # A00919-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SLC26A4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00919-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SLC26A4, which shares 84.4% amino acid (aa) sequence identity with both mouse and rat SCNN1A.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00919-1 is reactive to SLC26A4 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
86 kDa
Calculated molecular weight
85.723kDa
Background of SLC26A4
Pendrin, is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear; however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00919-1 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human HK-2 whole cell, human 293T whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SLC26A4 using anti-SLC26A4 antibody (A00919-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HK-2 whole cell lysates,
Lane 2: human 293T whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC26A4 antigen affinity purified polyclonal antibody (Catalog # A00919-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SLC26A4 at approximately 86KD. The expected band size for SLC26A4 is at 86KD.
Protein Target Info & Infographic
Gene/Protein Information For SLC26A4 (Source: Uniprot.org, NCBI)
Gene Name
SLC26A4
Full Name
Pendrin
Weight
85.723kDa
Superfamily
SLC26A/SulP transporter (TC 2.A.53) family
Alternative Names
Pendrin; Sodium-independent chloride/iodide transporter; Solute carrier family 26 member 4; SLC26A4; PDS SLC26A4 DFNB4, EVA, PDS, TDH2B solute carrier family 26 member 4 pendrin|sodium-independent chloride/iodide transporter|solute carrier family 26 (anion exchanger), member 4|truncated solute carrier family 26
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SLC26A4, check out the SLC26A4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SLC26A4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SLC26A4 Antibody Picoband® (A00919-1)
Hello CJ!
No publications found for A00919-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SLC26A4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SLC26A4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
3 Customer Q&As for Anti-SLC26A4 Antibody Picoband®
Question
Is this A00919-1 anti-SLC26A4 antibody reactive to the isotypes of SLC26A4?
D. Jones
Verified customer
Asked: 2019-10-10
Answer
The immunogen of A00919-1 anti-SLC26A4 antibody is A synthetic peptide corresponding to a sequence of human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-10
Question
Is there a BSA free version of anti-SLC26A4 antibody A00919-1 available?
Verified Customer
Verified customer
Asked: 2018-12-26
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-SLC26A4 antibody A00919-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-12-26
Question
We are currently using anti-SLC26A4 antibody A00919-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?
O. Jha
Verified customer
Asked: 2016-04-14
Answer
The anti-SLC26A4 antibody (A00919-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-04-14
