Anti-DNA pol beta Antibody

DNA Polymerase beta antibody

Boster Bio Anti-DNA pol beta Antibody catalog # A01946-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01946-1
Size: 100μl
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-DNA pol beta Antibody

View all DNA Polymerase beta Antibodies

SKU/Catalog Number

A01946-1

Size

100μl

Form

Liquid

Description

Boster Bio Anti-DNA pol beta Antibody catalog # A01946-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-DNA pol beta Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01946-1)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1 Synthetic peptide LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross reactivity with other proteins.

Reactive Species

A01946-1 is reactive to POLB in Human, Mouse, Rat

Applications

A01946-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

38178 MW

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Restore with deionized water (or equivalent) for reconstitution volume of 100 µL

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000

Validation Images & Assay Conditions

Gene/Protein Information For POLB (Source: Uniprot.org, NCBI)

Gene Name

POLB

Full Name

DNA polymerase beta

Weight

38178 MW

Superfamily

DNA polymerase type-X family

Alternative Names

DNA pol beta; DNA polymerase beta subunit; DNA Polymerase beta; EC 2.7.7.7; EC 4.2.99.-; MGC125976; POLB; polymerase (DNA directed), beta POLB DNA polymerase beta DNA polymerase beta|DNA pol beta|DNA polymerase beta subunit|polymerase (DNA directed), beta|polymerase (DNA) beta

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on POLB, check out the POLB Infographic

POLB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01946-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-DNA pol beta Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-DNA pol beta Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-DNA pol beta Antibody

Order DetailsPrice
A01946-1

100uL

$399

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01946-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$399.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.