Anti-CLEC9A Antibody Picoband™

Clec9a antibody

Boster Bio Anti-CLEC9A Antibody Picoband™ catalog # A04577. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human.

Product Info Summary

SKU: A04577
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, ICC

Product Name

Anti-CLEC9A Antibody Picoband™

View all Clec9a Antibodies

SKU/Catalog Number

A04577

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CLEC9A Antibody Picoband™ catalog # A04577. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CLEC9A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04577)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human CLEC9A, which shares 47.5% and 55% amino acid (aa) sequence identity with mouse and rat CLEC9A, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04577 is reactive to Clec9a in Human

Applications

A04577 is guaranteed for Flow Cytometry, IHC, ICC Boster Guarantee

Observed Molecular Weight

70 kDa

Calculated molecular weight

Background of Clec9a

C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For Clec9a (Source: Uniprot.org, NCBI)

Gene Name

Clec9a

Full Name

C-type lectin domain family 9 member A

Weight

Alternative Names

CD370; CLEC9a; C-type lectin domain family 9 member A; C-type lectin domain family 9, member A; DNGR1; HEEE9341; UNQ9341 Clec9a|9830005G06Rik, DNGR, DNGR-1|C-type lectin domain family 9, member a|C-type lectin domain family 9 member A|dendritic cell natural killer lectin group receptor 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Clec9a, check out the Clec9a Infographic

Clec9a infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Clec9a: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04577

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CLEC9A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-CLEC9A Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-CLEC9A Antibody Picoband™

Question

Is this A04577 anti-CLEC9A antibody reactive to the isotypes of CLEC9A?

Verified Customer

Verified customer

Asked: 2020-04-30

Answer

The immunogen of A04577 anti-CLEC9A antibody is A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-30

Question

I was wanting to use your anti-CLEC9A antibody for ICC for human substantia nigra on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human substantia nigra identification?

Verified Customer

Verified customer

Asked: 2020-03-26

Answer

It shows on the product datasheet, A04577 anti-CLEC9A antibody has been tested for Flow Cytometry, IHC, ICC on human tissues. We have an innovator award program that if you test this antibody and show it works in human substantia nigra in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-03-26

Question

Does anti-CLEC9A antibody A04577 work on feline IHC with substantia nigra?

Verified Customer

Verified customer

Asked: 2020-02-24

Answer

Our lab technicians have not tested anti-CLEC9A antibody A04577 on feline. You can run a BLAST between feline and the immunogen sequence of anti-CLEC9A antibody A04577 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline substantia nigra in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-24

Question

My question regarding product A04577, anti-CLEC9A antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-09-23

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04577 anti-CLEC9A antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-09-23

Question

I see that the anti-CLEC9A antibody A04577 works with ICC, what is the protocol used to produce the result images on the product page?

T. Wu

Verified customer

Asked: 2019-09-06

Answer

You can find protocols for ICC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-06

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-CLEC9A antibody A04577. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-15

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-15

Question

See below the WB image, lot number and protocol we used for substantia nigra using anti-CLEC9A antibody A04577. Please let me know if you require anything else.

T. Dhar

Verified customer

Asked: 2019-04-16

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-16

Question

We need to test anti-CLEC9A antibody A04577 on human substantia nigra for research purposes, then I may be interested in using anti-CLEC9A antibody A04577 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-10-04

Answer

The products we sell, including anti-CLEC9A antibody A04577, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-10-04

Question

Will A04577 anti-CLEC9A antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

A. Baker

Verified customer

Asked: 2018-07-24

Answer

You can see on the product datasheet, A04577 anti-CLEC9A antibody as been validated on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-07-24

Question

Do you have a BSA free version of anti-CLEC9A antibody A04577 available?

D. Moore

Verified customer

Asked: 2018-07-12

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CLEC9A antibody A04577 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-07-12

Question

Would anti-CLEC9A antibody A04577 work for ICC with substantia nigra?

Verified Customer

Verified customer

Asked: 2018-07-06

Answer

According to the expression profile of substantia nigra, CLEC9A is highly expressed in substantia nigra. So, it is likely that anti-CLEC9A antibody A04577 will work for ICC with substantia nigra.

Boster Scientific Support

Answered: 2018-07-06

Question

We need using your anti-CLEC9A antibody for receptor-mediated endocytosis studies. Has this antibody been tested with western blotting on jurkat cells? We would like to see some validation images before ordering.

Z. Huang

Verified customer

Asked: 2015-03-27

Answer

We appreciate your inquiry. This A04577 anti-CLEC9A antibody is tested on jurkat cells. It is guaranteed to work for Flow Cytometry, IHC, ICC in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2015-03-27

Question

We are currently using anti-CLEC9A antibody A04577 for human tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on zebrafish tissues as well?

J. Anderson

Verified customer

Asked: 2014-02-17

Answer

The anti-CLEC9A antibody (A04577) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-02-17

Question

Is a blocking peptide available for product anti-CLEC9A antibody (A04577)?

M. Collins

Verified customer

Asked: 2013-09-25

Answer

We do provide the blocking peptide for product anti-CLEC9A antibody (A04577). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-09-25

Order DetailsPrice
A04577

100μg

$370
A04577-10ug

10μg sample (liquid)

$99
A04577-Biotin

100 μg Biotin conjugated

$570
A04577-Cy3

100 μg Cy3 conjugated

$570
A04577-Dylight488

100 μg Dylight488 conjugated

$570
A04577-Dylight550

100 μg Dylight550 conjugated

$570
A04577-Dylight594

100 μg Dylight594 conjugated

$570
A04577-FITC

100 μg FITC conjugated

$570
A04577-HRP

100 μg HRP conjugated

$570
A04577-APC

100 μg APC conjugated

$670
A04577-PE

100 μg PE conjugated

$670
A04577-iFluor647

100 μg iFluor647 conjugated

$670
A04577-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04577
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.