Click image to see more details
Product Info Summary
| SKU: | A04577 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, ICC |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CLEC9A Antibody
SKU/Catalog Number
A04577
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CLEC9A Antibody catalog # A04577. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CLEC9A Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04577)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human CLEC9A, which shares 47.5% and 55% amino acid (aa) sequence identity with mouse and rat CLEC9A, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04577 is reactive to CLEC9A in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
70 kDa
Calculated molecular weight
27.014kDa
Background of Clec9a
C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A04577 is guaranteed for Flow Cytometry, IHC, ICC Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
FCM: Jurkat cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Flow Cytometry analysis of Jurkat cells using anti-CLEC9A antibody (A04577).
Overlay histogram showing Jurkat cells stained with A04577 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CLEC9A Antibody (A04577, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For CLEC9A (Source: Uniprot.org, NCBI)
Gene Name
CLEC9A
Full Name
C-type lectin domain family 9 member A
Weight
27.014kDa
Alternative Names
C-type lectin domain family 9 member A; CLEC9A; UNQ9341/PRO34046 Clec9a|9830005G06Rik, DNGR, DNGR-1|C-type lectin domain family 9, member a|C-type lectin domain family 9 member A|dendritic cell natural killer lectin group receptor 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CLEC9A, check out the CLEC9A Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CLEC9A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CLEC9A Antibody (A04577)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CLEC9A Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CLEC9A Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-CLEC9A Antibody
Question
Is this A04577 anti-CLEC9A antibody reactive to the isotypes of CLEC9A?
Verified Customer
Verified customer
Asked: 2020-04-30
Answer
The immunogen of A04577 anti-CLEC9A antibody is A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-30
Question
I was wanting to use your anti-CLEC9A antibody for ICC for human substantia nigra on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human substantia nigra identification?
Verified Customer
Verified customer
Asked: 2020-03-26
Answer
It shows on the product datasheet, A04577 anti-CLEC9A antibody has been tested for Flow Cytometry, IHC, ICC on human tissues. We have an innovator award program that if you test this antibody and show it works in human substantia nigra in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-03-26
Question
Does anti-CLEC9A antibody A04577 work on feline IHC with substantia nigra?
Verified Customer
Verified customer
Asked: 2020-02-24
Answer
Our lab technicians have not tested anti-CLEC9A antibody A04577 on feline. You can run a BLAST between feline and the immunogen sequence of anti-CLEC9A antibody A04577 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline substantia nigra in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-24
Question
My question regarding product A04577, anti-CLEC9A antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-09-23
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04577 anti-CLEC9A antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-09-23
Question
I see that the anti-CLEC9A antibody A04577 works with ICC, what is the protocol used to produce the result images on the product page?
T. Wu
Verified customer
Asked: 2019-09-06
Answer
You can find protocols for ICC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-09-06
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for substantia nigra using anti-CLEC9A antibody A04577. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-15
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-15
Question
See below the WB image, lot number and protocol we used for substantia nigra using anti-CLEC9A antibody A04577. Please let me know if you require anything else.
T. Dhar
Verified customer
Asked: 2019-04-16
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-04-16
Question
We need to test anti-CLEC9A antibody A04577 on human substantia nigra for research purposes, then I may be interested in using anti-CLEC9A antibody A04577 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-10-04
Answer
The products we sell, including anti-CLEC9A antibody A04577, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-10-04
Question
Will A04577 anti-CLEC9A antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
A. Baker
Verified customer
Asked: 2018-07-24
Answer
You can see on the product datasheet, A04577 anti-CLEC9A antibody as been validated on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-07-24
Question
Do you have a BSA free version of anti-CLEC9A antibody A04577 available?
D. Moore
Verified customer
Asked: 2018-07-12
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CLEC9A antibody A04577 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-07-12
Question
Would anti-CLEC9A antibody A04577 work for ICC with substantia nigra?
Verified Customer
Verified customer
Asked: 2018-07-06
Answer
According to the expression profile of substantia nigra, CLEC9A is highly expressed in substantia nigra. So, it is likely that anti-CLEC9A antibody A04577 will work for ICC with substantia nigra.
Boster Scientific Support
Answered: 2018-07-06
Question
We need using your anti-CLEC9A antibody for receptor-mediated endocytosis studies. Has this antibody been tested with western blotting on jurkat cells? We would like to see some validation images before ordering.
Z. Huang
Verified customer
Asked: 2015-03-27
Answer
We appreciate your inquiry. This A04577 anti-CLEC9A antibody is tested on jurkat cells. It is guaranteed to work for Flow Cytometry, IHC, ICC in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2015-03-27
Question
We are currently using anti-CLEC9A antibody A04577 for human tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on zebrafish tissues as well?
J. Anderson
Verified customer
Asked: 2014-02-17
Answer
The anti-CLEC9A antibody (A04577) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2014-02-17
Question
Is a blocking peptide available for product anti-CLEC9A antibody (A04577)?
M. Collins
Verified customer
Asked: 2013-09-25
Answer
We do provide the blocking peptide for product anti-CLEC9A antibody (A04577). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2013-09-25
