Click image to see more details
Product Info Summary
| SKU: | PB9692 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Chk2/CHEK2 Antibody Picoband®
SKU/Catalog Number
PB9692
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Chk2/CHEK2 Antibody Picoband® catalog # PB9692. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Chk2/CHEK2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9692)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2, different from the related mouse sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9692 is reactive to CHEK2 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
65 kDa
Calculated molecular weight
60915 MW
Background of Chk2
CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9692 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: Rat Spleen Tissue, Mouse Testis Tissue, SW620 Whole Cell
IHC: human lung cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Chk2 using anti-Chk2 antibody (PB9692).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Spleen Tissue Lysate at 50ug,
Lane 2: Mouse Testis Tissue Lysate at 50ug,
Lane 3: SW620 Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Chk2 antigen affinity purified polyclonal antibody (Catalog # PB9692) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Chk2 at approximately 65 kDa. The expected band size for Chk2 is at 65 kDa.
Click image to see more details
Figure 2. IHC analysis of Chk2 using anti-Chk2 antibody (PB9692).
Chk2 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-Chk2 Antibody (PB9692) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For CHEK2 (Source: Uniprot.org, NCBI)
Gene Name
CHEK2
Full Name
Serine/threonine-protein kinase Chk2
Weight
60915 MW
Superfamily
protein kinase superfamily
Alternative Names
Serine/threonine-protein kinase Chk2;2.7.11.1;CHK2 checkpoint homolog;Cds1 homolog;Hucds1;hCds1;Checkpoint kinase 2;CHEK2;CDS1, CHK2, RAD53; CHEK2 CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, hCds1 checkpoint kinase 2 serine/threonine-protein kinase Chk2|CHK2 checkpoint homolog|cds1 homolog|checkpoint-like protein CHK2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CHEK2, check out the CHEK2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CHEK2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Chk2/CHEK2 Antibody Picoband® (PB9692)
Hello CJ!
No publications found for PB9692
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Chk2/CHEK2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Chk2/CHEK2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-Chk2/CHEK2 Antibody Picoband®
Question
I see that the anti-Chk2/CHEK2 antibody PB9692 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-03
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-03
Question
We were satisfied with the WB result of your anti-Chk2/CHEK2 antibody. However we have been able to see positive staining in t-cell isoform 2: nucleus. note=isoform 10 is using this antibody. Is that expected? Could you tell me where is CHEK2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
According to literature, t-cell does express CHEK2. Generally CHEK2 expresses in isoform 2: nucleus. note=isoform 10 is, isoform 4: nucleus., isoform 7: nucleus., isoform 9: nucleus., isoform 12: nucleus., nucleus, pml body. nucleus, nucleoplasm. Regarding which tissues have CHEK2 expression, here are a few articles citing expression in various tissues:
Mammary gland, Pubmed ID: 15361853
Muscle, Pubmed ID: 15489334
T-cell, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-03-24
Question
Is a blocking peptide available for product anti-Chk2/CHEK2 antibody (PB9692)?
Verified Customer
Verified customer
Asked: 2020-01-23
Answer
We do provide the blocking peptide for product anti-Chk2/CHEK2 antibody (PB9692). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-23
Question
We have tried in the past anti-Chk2/CHEK2 antibody for IHC on muscle a few months ago. I am using human, and We want to use the antibody for WB next. We want examining muscle as well as tibial nerve in our next experiment. Do you have any suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2019-11-27
Answer
I took a look at the website and datasheets of our anti-Chk2/CHEK2 antibody and it seems that PB9692 has been validated on human in both IHC and WB. Thus PB9692 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-11-27
Question
I was wanting to use your anti-Chk2/CHEK2 antibody for WB for rat t-cell on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat t-cell identification?
Verified Customer
Verified customer
Asked: 2019-11-06
Answer
You can see on the product datasheet, PB9692 anti-Chk2/CHEK2 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-11-06
Question
Can you help my question with product PB9692, anti-Chk2/CHEK2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-08-02
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9692 anti-Chk2/CHEK2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-08-02
Question
We have observed staining in mouse mammary gland. Do you have any suggestions? Is anti-Chk2/CHEK2 antibody supposed to stain mammary gland positively?
Verified Customer
Verified customer
Asked: 2019-04-11
Answer
According to literature mammary gland does express CHEK2. According to Uniprot.org, CHEK2 is expressed in tibial nerve, mammary gland, colon carcinoma, t-cell, muscle, among other tissues. Regarding which tissues have CHEK2 expression, here are a few articles citing expression in various tissues:
Mammary gland, Pubmed ID: 15361853
Muscle, Pubmed ID: 15489334
T-cell, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-04-11
Question
I would like to test anti-Chk2/CHEK2 antibody PB9692 on rat t-cell for research purposes, then I may be interested in using anti-Chk2/CHEK2 antibody PB9692 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-03-29
Answer
The products we sell, including anti-Chk2/CHEK2 antibody PB9692, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-03-29
Question
I have attached the WB image, lot number and protocol we used for t-cell using anti-Chk2/CHEK2 antibody PB9692. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-01-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-11
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for t-cell using anti-Chk2/CHEK2 antibody PB9692. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-06-05
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-05
Question
Is this PB9692 anti-Chk2/CHEK2 antibody reactive to the isotypes of CHEK2?
Verified Customer
Verified customer
Asked: 2018-03-20
Answer
The immunogen of PB9692 anti-Chk2/CHEK2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-03-20
Question
Will anti-Chk2/CHEK2 antibody PB9692 work for WB with t-cell?
R. Miller
Verified customer
Asked: 2018-01-22
Answer
According to the expression profile of t-cell, CHEK2 is highly expressed in t-cell. So, it is likely that anti-Chk2/CHEK2 antibody PB9692 will work for WB with t-cell.
Boster Scientific Support
Answered: 2018-01-22
Question
Does PB9692 anti-Chk2/CHEK2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-06-06
Answer
You can see on the product datasheet, PB9692 anti-Chk2/CHEK2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-06-06
Question
My lab would like using your anti-Chk2/CHEK2 antibody for dna damage checkpoint studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
P. Mangal
Verified customer
Asked: 2016-12-01
Answer
We appreciate your inquiry. This PB9692 anti-Chk2/CHEK2 antibody is validated on rat spleen tissue, tissue lysate, mouse testis tissue, sw620 whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2016-12-01
Question
Is there a BSA free version of anti-Chk2/CHEK2 antibody PB9692 available?
R. Jha
Verified customer
Asked: 2014-02-26
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Chk2/CHEK2 antibody PB9692 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-02-26
Question
We are currently using anti-Chk2/CHEK2 antibody PB9692 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?
C. Kulkarni
Verified customer
Asked: 2013-06-25
Answer
The anti-Chk2/CHEK2 antibody (PB9692) has not been validated for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-06-25
