Product Info Summary
SKU: | PB9848 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Mouse |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CD46 Antibody Picoband®
SKU/Catalog Number
PB9848
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CD46 Antibody Picoband® catalog # PB9848. Tested in WB applications. This antibody reacts with Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CD46 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9848)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46, different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9848 is reactive to Cd46 in Mouse
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
41 kDa, 70 kDa
Calculated molecular weight
40881 MW
Background of CD46
CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9848 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse
Positive Control
WB: mouse testis tissue, NIH/3T3 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CD46 using anti-CD46 antibody (PB9848).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: mouse testis tissue lysates,
Lane 2: NIH/3T3 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD46 antigen affinity purified polyclonal antibody (Catalog # PB9848) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CD46 at approximately 41 kDa, 70 kDa. The expected band size for CD46 is at 41 kDa.
Protein Target Info & Infographic
Gene/Protein Information For Cd46 (Source: Uniprot.org, NCBI)
Gene Name
Cd46
Full Name
Membrane cofactor protein
Weight
40881 MW
Alternative Names
Membrane cofactor protein;CD46;Cd46;Mcp; CD46 AHUS2, MCP, MIC10, TLX, TRA2.10 CD46 molecule membrane cofactor protein|CD46 , complement regulatory protein|CD46 molecule, complement regulatory protein| by TRA-2-10|complement membrane cofactor protein|measles virus receptor|membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive )|trophoblast leucocyte common |trophoblast leukocyte common |trophoblast-lymphocyte cross-reactive
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Cd46, check out the Cd46 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Cd46: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CD46 Antibody Picoband® (PB9848)
Hello CJ!
No publications found for PB9848
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CD46 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-CD46 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-CD46 Antibody Picoband®
Question
See attached the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-01-31
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-31
Question
I was wanting to use to test anti-CD46 antibody PB9848 on mouse palpebral conjunctiva for research purposes, then I may be interested in using anti-CD46 antibody PB9848 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
L. Wu
Verified customer
Asked: 2020-01-28
Answer
The products we sell, including anti-CD46 antibody PB9848, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-01-28
Question
I see that the anti-CD46 antibody PB9848 works with WB, what is the protocol used to produce the result images on the product page?
C. Collins
Verified customer
Asked: 2019-10-30
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-10-30
Question
Is this PB9848 anti-CD46 antibody reactive to the isotypes of CD46?
Verified Customer
Verified customer
Asked: 2019-10-16
Answer
The immunogen of PB9848 anti-CD46 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-16
Question
Is a blocking peptide available for product anti-CD46 antibody (PB9848)?
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
We do provide the blocking peptide for product anti-CD46 antibody (PB9848). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-09-11
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-13
Question
Is there a BSA free version of anti-CD46 antibody PB9848 available?
Verified Customer
Verified customer
Asked: 2019-07-29
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CD46 antibody PB9848 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-07-29
Question
Does anti-CD46 antibody PB9848 work for WB with palpebral conjunctiva?
Verified Customer
Verified customer
Asked: 2019-06-25
Answer
According to the expression profile of palpebral conjunctiva, CD46 is highly expressed in palpebral conjunctiva. So, it is likely that anti-CD46 antibody PB9848 will work for WB with palpebral conjunctiva.
Boster Scientific Support
Answered: 2019-06-25
Question
We have seen staining in mouse sperm. Any tips? Is anti-CD46 antibody supposed to stain sperm positively?
Verified Customer
Verified customer
Asked: 2019-06-17
Answer
According to literature sperm does express CD46. According to Uniprot.org, CD46 is expressed in palpebral conjunctiva, testis, teratocarcinoma, fetal kidney, liver salivary gland, liver, sperm, among other tissues. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334
Boster Scientific Support
Answered: 2019-06-17
Question
I have a question about product PB9848, anti-CD46 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-03-22
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9848 anti-CD46 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-03-22
Question
I was wanting to use your anti-CD46 antibody for WB for mouse palpebral conjunctiva on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse palpebral conjunctiva identification?
F. Parker
Verified customer
Asked: 2018-02-08
Answer
It shows on the product datasheet, PB9848 anti-CD46 antibody has been validated for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse palpebral conjunctiva in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-02-08
Question
We are currently using anti-CD46 antibody PB9848 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on canine tissues as well?
M. Collins
Verified customer
Asked: 2018-01-22
Answer
The anti-CD46 antibody (PB9848) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-01-22
Question
Will PB9848 anti-CD46 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
M. Miller
Verified customer
Asked: 2015-11-12
Answer
It shows on the product datasheet, PB9848 anti-CD46 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2015-11-12
Question
My lab would like using your anti-CD46 antibody for positive regulation of regulatory t cell differentiation studies. Has this antibody been tested with western blotting on nih3t3 whole cell lysates? We would like to see some validation images before ordering.
M. Baker
Verified customer
Asked: 2015-04-15
Answer
We appreciate your inquiry. This PB9848 anti-CD46 antibody is validated on nih3t3 whole cell lysates. It is guaranteed to work for WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2015-04-15
Question
Does anti-CD46 antibody PB9848 work on bovine WB with liver salivary gland?
A. Parker
Verified customer
Asked: 2014-06-12
Answer
Our lab technicians have not tested anti-CD46 antibody PB9848 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-CD46 antibody PB9848 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine liver salivary gland in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-06-12
Question
My team were content with the WB result of your anti-CD46 antibody. However we have been able to see positive staining in teratocarcinoma secretory vesicle, using this antibody. Is that expected? Could you tell me where is CD46 supposed to be expressed?
H. Parker
Verified customer
Asked: 2013-09-03
Answer
From what I have seen in literature, teratocarcinoma does express CD46. Generally CD46 expresses in cytoplasmic vesicle, secretory vesicle,. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334
Boster Scientific Support
Answered: 2013-09-03