ALR (GFER) (NM_005262) Human Recombinant Protein

GFER/ALR protein,

Product Info Summary

SKU: PROTP55789
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ALR (GFER) (NM_005262) Human Recombinant Protein

View all GFER/ALR recombinant proteins

SKU/Catalog Number

PROTP55789

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human growth factor, augmenter of liver regeneration (GFER)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ALR (GFER) (NM_005262) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55789)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.3 kDa

Amino Acid Sequence

MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Validation Images & Assay Conditions

Gene/Protein Information For GFER (Source: Uniprot.org, NCBI)

Gene Name

GFER

Full Name

FAD-linked sulfhydryl oxidase ALR

Weight

23.3 kDa

Alternative Names

ALR; ALRFAD-linked sulfhydryl oxidase ALR; Augmenter of liver regeneration; EC 1.8.3.2; ERV1 homolog; ERV1; ERV1hepatopoietin protein; erv1-like growth factor; GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration); Hepatopoietin; HERV1; HERV1hepatic regenerative stimulation substance; HPO; HPO1; HPO2; HSS; truncated augmenter of liver regeneration GFER ALR, ERV1, HERV1, HPO, HPO1, HPO2, HSS, MMCHD, MPMCD growth factor, augmenter of liver regeneration FAD-linked sulfhydryl oxidase ALR|ERV1 homolog|erv1-like growth factor|hepatic regenerative stimulation substance|hepatopoietin protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GFER, check out the GFER Infographic

GFER infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GFER: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55789

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ALR (GFER) (NM_005262) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ALR (GFER) (NM_005262) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ALR (GFER) (NM_005262) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55789
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.