AKR1C2 (NM_205845) Human Recombinant Protein

AKR1C2 protein,

Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), tran

Product Info Summary

SKU: PROTP52895
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

AKR1C2 (NM_205845) Human Recombinant Protein

View all AKR1C2 recombinant proteins

SKU/Catalog Number

PROTP52895

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) (AKR1C2), tran

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

AKR1C2 (NM_205845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52895)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.6 kDa

Amino Acid Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Validation Images & Assay Conditions

Gene/Protein Information For AKR1C2 (Source: Uniprot.org, NCBI)

Gene Name

AKR1C2

Full Name

Aldo-keto reductase family 1 member C2

Weight

36.6 kDa

Superfamily

aldo/keto reductase family

Alternative Names

aldo-keto reductase family 1 member C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III); BABP; Chlordecone reductase homolog HAKRD; DD; DD-2; DD2DD/BABP; DDH2FLJ53800; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid-binding protein; EC 1.1.1,3-alpha-HSD3; EC 1.1.1.213; EC 1.3.1.20; HAKRDAKR1C-pseudo; HBAB; MCDR2; pseudo-chlordecone reductase; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type II dihydrodiol dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase AKR1C2 AKR1C-pseudo, BABP, DD, DD-2, DD/BABP, DD2, DDH2, HAKRD, HBAB, MCDR2, SRXY8, TDD aldo-keto reductase family 1 member C2 aldo-keto reductase family 1 member C2|3-alpha-HSD3|chlordecone reductase homolog HAKRD|dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III|pseudo-chlordecone reductase|testicular 17,20-desmolase deficiency|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|type II dihydrodiol dehydrogenase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on AKR1C2, check out the AKR1C2 Infographic

AKR1C2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AKR1C2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52895

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used AKR1C2 (NM_205845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For AKR1C2 (NM_205845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for AKR1C2 (NM_205845) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52895
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.