Click image to see more details
Product Info Summary
| SKU: | A00835-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry, IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Bile Acid Receptor NR1H4 Antibody Picoband®
SKU/Catalog Number
A00835-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Bile Acid Receptor NR1H4 Antibody Picoband® catalog # A00835-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Bile Acid Receptor NR1H4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00835-1)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00835-1 is reactive to NR1H4 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
56 kDa
Calculated molecular weight
55914 MW
Background of FXR/NR1H4
The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00835-1 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human HCCT tissue, human HCCP tissue
ICC/IF: A549 cell
FCM: A549 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of NR1H4 using anti-NR1H4 antibody (A00835-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HCCT tissue lysates,
Lane 2: human HCCP tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-NR1H4 antigen affinity purified polyclonal antibody (Catalog # A00835-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for NR1H4 at approximately 56 kDa. The expected band size for NR1H4 is at 56 kDa.
Click image to see more details
Figure 2. IF analysis of NR1H4 using anti-NR1H4 antibody (A00835-1).
NR1H4 was detected in immunocytochemical section of A549 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-NR1H4 Antibody (A00835-1) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 3. Flow Cytometry analysis of A549 cells using anti- NR1H4 antibody (A00835-1).
Overlay histogram showing A549 cells stained with A00835-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti- NR1H4 Antibody (A00835-1, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For NR1H4 (Source: Uniprot.org, NCBI)
Gene Name
NR1H4
Full Name
Bile acid receptor
Weight
55914 MW
Superfamily
nuclear hormone receptor family
Alternative Names
Bile acid receptor;Farnesoid X-activated receptor;Farnesol receptor HRR-1;Nuclear receptor subfamily 1 group H member 4;Retinoid X receptor-interacting protein 14;RXR-interacting protein 14;NR1H4;BAR, FXR, HRR1, RIP14; NR1H4 BAR, FXR, HRR-1, HRR1, PFIC5, RIP14 nuclear receptor subfamily 1 group H member 4 bile acid receptor|RXR-interacting protein 14|farnesoid X nuclear receptor|farnesoid X-activated receptor|farnesol receptor HRR-1|retinoid X receptor-interacting protein 14
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NR1H4, check out the NR1H4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NR1H4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Bile Acid Receptor NR1H4 Antibody Picoband® (A00835-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Bile Acid Receptor NR1H4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Bile Acid Receptor NR1H4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Bile Acid Receptor NR1H4 Antibody Picoband®
Question
I was wanting to use your anti-Bile Acid Receptor NR1H4 antibody for WB for mouse colon on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse colon identification?
Verified Customer
Verified customer
Asked: 2020-02-12
Answer
As indicated on the product datasheet, A00835-1 anti-Bile Acid Receptor NR1H4 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse colon in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-12
Question
Would A00835-1 anti-Bile Acid Receptor NR1H4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-01
Answer
As indicated on the product datasheet, A00835-1 anti-Bile Acid Receptor NR1H4 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-01
Question
Is a blocking peptide available for product anti-Bile Acid Receptor NR1H4 antibody (A00835-1)?
Verified Customer
Verified customer
Asked: 2019-12-12
Answer
We do provide the blocking peptide for product anti-Bile Acid Receptor NR1H4 antibody (A00835-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-12
Question
We are currently using anti-Bile Acid Receptor NR1H4 antibody A00835-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on goat tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-27
Answer
The anti-Bile Acid Receptor NR1H4 antibody (A00835-1) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-27
Question
We are interested in to test anti-Bile Acid Receptor NR1H4 antibody A00835-1 on mouse colon for research purposes, then I may be interested in using anti-Bile Acid Receptor NR1H4 antibody A00835-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-05-16
Answer
The products we sell, including anti-Bile Acid Receptor NR1H4 antibody A00835-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-05-16
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon using anti-Bile Acid Receptor NR1H4 antibody A00835-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-03-04
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-03-04
Question
Is this A00835-1 anti-Bile Acid Receptor NR1H4 antibody reactive to the isotypes of NR1H4?
B. Anderson
Verified customer
Asked: 2013-08-27
Answer
The immunogen of A00835-1 anti-Bile Acid Receptor NR1H4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4 (442-486aa QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-08-27
