Anti-Bile Acid Receptor NR1H4 Antibody Picoband™

FXR/NR1H4 antibody

Boster Bio Anti-Bile Acid Receptor NR1H4 Antibody Picoband™ catalog # A00835-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A00835-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-Bile Acid Receptor NR1H4 Antibody Picoband™

View all FXR/NR1H4 Antibodies

SKU/Catalog Number

A00835-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Bile Acid Receptor NR1H4 Antibody Picoband™ catalog # A00835-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Bile Acid Receptor NR1H4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00835-1)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00835-1 is reactive to NR1H4 in Human

Applications

A00835-1 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

Observed Molecular Weight

56 kDa

Calculated molecular weight

55914 MW

Background of FXR/NR1H4

The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For NR1H4 (Source: Uniprot.org, NCBI)

Gene Name

NR1H4

Full Name

Bile acid receptor

Weight

55914 MW

Superfamily

nuclear hormone receptor family

Alternative Names

BAR; bile acid receptor; farnesoid X receptor; Farnesoid X-activated receptor; Farnesol receptor HRR-1; FXR; FXRBAR; HRR-1; HRR1MGC163445; NR1H4; Nuclear receptor subfamily 1 group H member 4; nuclear receptor subfamily 1, group H, member 4; Retinoid X receptor-interacting protein 14; RIP14; RIP14RXR-interacting protein 14 NR1H4 BAR, FXR, HRR-1, HRR1, PFIC5, RIP14 nuclear receptor subfamily 1 group H member 4 bile acid receptor|RXR-interacting protein 14|farnesoid X nuclear receptor|farnesoid X-activated receptor|farnesol receptor HRR-1|retinoid X receptor-interacting protein 14

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NR1H4, check out the NR1H4 Infographic

NR1H4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NR1H4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00835-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Bile Acid Receptor NR1H4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Bile Acid Receptor NR1H4 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Bile Acid Receptor NR1H4 Antibody Picoband™

Question

I was wanting to use your anti-Bile Acid Receptor NR1H4 antibody for WB for mouse colon on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse colon identification?

Verified Customer

Verified customer

Asked: 2020-02-12

Answer

As indicated on the product datasheet, A00835-1 anti-Bile Acid Receptor NR1H4 antibody has been validated for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse colon in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-12

Question

Would A00835-1 anti-Bile Acid Receptor NR1H4 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

As indicated on the product datasheet, A00835-1 anti-Bile Acid Receptor NR1H4 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-01-01

Question

Is a blocking peptide available for product anti-Bile Acid Receptor NR1H4 antibody (A00835-1)?

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

We do provide the blocking peptide for product anti-Bile Acid Receptor NR1H4 antibody (A00835-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-12-12

Question

We are currently using anti-Bile Acid Receptor NR1H4 antibody A00835-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

The anti-Bile Acid Receptor NR1H4 antibody (A00835-1) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-05-27

Question

We are interested in to test anti-Bile Acid Receptor NR1H4 antibody A00835-1 on mouse colon for research purposes, then I may be interested in using anti-Bile Acid Receptor NR1H4 antibody A00835-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-16

Answer

The products we sell, including anti-Bile Acid Receptor NR1H4 antibody A00835-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-16

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon using anti-Bile Acid Receptor NR1H4 antibody A00835-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-03-04

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-03-04

Question

Is this A00835-1 anti-Bile Acid Receptor NR1H4 antibody reactive to the isotypes of NR1H4?

B. Anderson

Verified customer

Asked: 2013-08-27

Answer

The immunogen of A00835-1 anti-Bile Acid Receptor NR1H4 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human NR1H4 (442-486aa QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-08-27

Order DetailsPrice
A00835-1

100μg

$370
A00835-1-10ug

10μg sample (liquid)

$99
A00835-1-Biotin

100 μg Biotin conjugated

$570
A00835-1-Cy3

100 μg Cy3 conjugated

$570
A00835-1-Dylight488

100 μg Dylight488 conjugated

$570
A00835-1-Dylight550

100 μg Dylight550 conjugated

$570
A00835-1-Dylight594

100 μg Dylight594 conjugated

$570
A00835-1-FITC

100 μg FITC conjugated

$570
A00835-1-HRP

100 μg HRP conjugated

$570
A00835-1-APC

100 μg APC conjugated

$670
A00835-1-PE

100 μg PE conjugated

$670
A00835-1-iFluor647

100 μg iFluor647 conjugated

$670
A00835-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00835-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.