ZPLD1 (NM_175056) Human Recombinant Protein

ZPLD1 protein,

Recombinant protein of human zona pellucida-like domain containing 1 (ZPLD1)

Product Info Summary

SKU: PROTQ8TCW7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZPLD1 (NM_175056) Human Recombinant Protein

View all ZPLD1 recombinant proteins

SKU/Catalog Number

PROTQ8TCW7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zona pellucida-like domain containing 1 (ZPLD1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZPLD1 (NM_175056) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TCW7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.2 kDa

Amino Acid Sequence

MMLRFSMCRGNDEGFAMEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFD

Validation Images & Assay Conditions

Gene/Protein Information For ZPLD1 (Source: Uniprot.org, NCBI)

Gene Name

ZPLD1

Full Name

Zona pellucida-like domain-containing protein 1

Weight

47.2 kDa

Alternative Names

zinc finger and homeodomain protein 1; zinc fingers and homeobox 1; zinc fingers and homeoboxes 1; zinc fingers and homeoboxes protein 1; zinc-fingers and homeoboxes 1 ZPLD1 zona pellucida like domain containing 1 zona pellucida-like domain-containing protein 1|ZP domain-containing protein 1|cupulin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZPLD1, check out the ZPLD1 Infographic

ZPLD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZPLD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TCW7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZPLD1 (NM_175056) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZPLD1 (NM_175056) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZPLD1 (NM_175056) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TCW7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.