ZNF580 (NM_016202) Human Recombinant Protein

ZNF580 protein,

Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1

Product Info Summary

SKU: PROTQ9UK33
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF580 (NM_016202) Human Recombinant Protein

View all ZNF580 recombinant proteins

SKU/Catalog Number

PROTQ9UK33

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 580 (ZNF580), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF580 (NM_016202) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UK33)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.6 kDa

Amino Acid Sequence

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH

Validation Images & Assay Conditions

Gene/Protein Information For ZNF580 (Source: Uniprot.org, NCBI)

Gene Name

ZNF580

Full Name

Zinc finger protein 580

Weight

18.6 kDa

Alternative Names

LDL induced EC protein; LDL-induced EC protein; zinc finger protein 580 ZNF580 zinc finger protein 580 zinc finger protein 580|LDL-induced EC protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF580, check out the ZNF580 Infographic

ZNF580 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF580: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UK33

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF580 (NM_016202) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF580 (NM_016202) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF580 (NM_016202) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UK33
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.