ZNF362 (NM_152493) Human Recombinant Protein

ZNF362 protein,

Recombinant protein of human zinc finger protein 362 (ZNF362)

Product Info Summary

SKU: PROTQ5T0B9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF362 (NM_152493) Human Recombinant Protein

View all ZNF362 recombinant proteins

SKU/Catalog Number

PROTQ5T0B9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 362 (ZNF362)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF362 (NM_152493) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5T0B9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.6 kDa

Amino Acid Sequence

MSRSSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGLSTRTPSVSTSESSAGAGTGTGTSTPSTPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHLSAHAIKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTESPGIPVRISLI

Validation Images & Assay Conditions

Gene/Protein Information For ZNF362 (Source: Uniprot.org, NCBI)

Gene Name

ZNF362

Full Name

Zinc finger protein 362

Weight

45.6 kDa

Superfamily

krueppel C2H2-type zinc-finger protein family

Alternative Names

HF.10; HF10Zinc finger protein HF.10; Zfp105; zinc finger protein 35 (clone HF.10); zinc finger protein 35 ZNF362 RN, lin-29 zinc finger protein 362 zinc finger protein 362|rotund homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF362, check out the ZNF362 Infographic

ZNF362 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF362: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5T0B9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF362 (NM_152493) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF362 (NM_152493) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF362 (NM_152493) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5T0B9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product