ZCCHC17 (NM_016505) Human Recombinant Protein

ZCCHC17 protein,

Product Info Summary

SKU: PROTQ9NP64
Size: 20 µg
Source: HEK293T

Product Name

ZCCHC17 (NM_016505) Human Recombinant Protein

View all ZCCHC17 recombinant proteins

SKU/Catalog Number

PROTQ9NP64

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger, CCHC domain containing 17 (ZCCHC17)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZCCHC17 (NM_016505) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NP64)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.4 kDa

Amino Acid Sequence

MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE

Validation Images & Assay Conditions

Gene/Protein Information For ZCCHC17 (Source: Uniprot.org, NCBI)

Gene Name

ZCCHC17

Full Name

Nucleolar protein of 40 kDa

Weight

27.4 kDa

Alternative Names

HSPC251; nucleolar protein of 40 kDa; Pnn-interacting nucleolar protein; pNO40nucleolar protein 40; PS1D protein; PS1DRP11-266K22.1; putative S1 RNA binding domain protein; Putative S1 RNA-binding domain protein; Zinc finger CCHC domain-containing protein 17; zinc finger, CCHC domain containing 17 ZCCHC17 HSPC251, PS1D, pNO40 zinc finger CCHC-type containing 17 nucleolar protein of 40 kDa|nucleolar protein 40|pnn-interacting nucleolar protein|putative S1 RNA binding domain protein|zinc finger CCHC domain-containing protein 17|zinc finger, CCHC domain containing 17

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZCCHC17, check out the ZCCHC17 Infographic

ZCCHC17 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZCCHC17: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NP64

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZCCHC17 (NM_016505) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZCCHC17 (NM_016505) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZCCHC17 (NM_016505) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NP64
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.