YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein

YAF2 protein,

Recombinant protein of human YY1 associated factor 2 (YAF2)

Product Info Summary

SKU: PROTQ8IY57
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein

View all YAF2 recombinant proteins

SKU/Catalog Number

PROTQ8IY57

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human YY1 associated factor 2 (YAF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IY57)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

Validation Images & Assay Conditions

Gene/Protein Information For YAF2 (Source: Uniprot.org, NCBI)

Gene Name

YAF2

Full Name

YY1-associated factor 2

Weight

19.7 kDa

Alternative Names

DKFZp779H1820; MGC41856; YY1 associated factor 2; YY1-associated factor 2 YAF2 YY1 associated factor 2 YY1-associated factor 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on YAF2, check out the YAF2 Infographic

YAF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for YAF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IY57

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IY57
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.