XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

XTP4 protein,

Product Info Summary

SKU: PROTQ9BRT3
Size: 20 µg
Source: HEK293T

Product Name

XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

View all XTP4 recombinant proteins

SKU/Catalog Number

PROTQ9BRT3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 17 open reading frame 37 (C17orf37)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

XTP4 (MIEN1) (NM_032339) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRT3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.2 kDa

Amino Acid Sequence

MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

Validation Images & Assay Conditions

Gene/Protein Information For MIEN1 (Source: Uniprot.org, NCBI)

Gene Name

MIEN1

Full Name

Migration and invasion enhancer 1

Weight

12.2 kDa

Superfamily

SelWTH family

Alternative Names

C35; chromosome 17 open reading frame 37; HBV XAg-transactivated protein 4; HBV X-transactivated gene 4 protein; MGC14832; ORB3; protein C17orf37; Protein C35; XTP4RDX12 MIEN1 C17orf37, C35, ORB3, RDX12, XTP4 migration and invasion enhancer 1 migration and invasion enhancer 1|HBV X-transactivated gene 4 protein|HBV XAg-transactivated protein 4|protein C17orf37

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIEN1, check out the MIEN1 Infographic

MIEN1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIEN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRT3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used XTP4 (MIEN1) (NM_032339) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for XTP4 (MIEN1) (NM_032339) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRT3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.