WDR61 (NM_025234) Human Recombinant Protein

Wdr61 protein,

Recombinant protein of human WD repeat domain 61 (WDR61)

Product Info Summary

SKU: PROTQ9GZS3
Size: 20 µg
Source: HEK293T

Product Name

WDR61 (NM_025234) Human Recombinant Protein

View all Wdr61 recombinant proteins

SKU/Catalog Number

PROTQ9GZS3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human WD repeat domain 61 (WDR61)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

WDR61 (NM_025234) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZS3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.4 kDa

Amino Acid Sequence

MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI

Validation Images & Assay Conditions

Gene/Protein Information For WDR61 (Source: Uniprot.org, NCBI)

Gene Name

WDR61

Full Name

WD repeat-containing protein 61

Weight

33.4 kDa

Alternative Names

Meiotic recombination REC14 protein homolog; REC14; recombination protein REC14; SKI8; WD repeat domain 61; WD repeat-containing protein 61

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on WDR61, check out the WDR61 Infographic

WDR61 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for WDR61: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZS3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used WDR61 (NM_025234) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For WDR61 (NM_025234) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for WDR61 (NM_025234) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZS3
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product