VPS25 (NM_032353) Human Recombinant Protein

Vps25 protein,

Product Info Summary

SKU: PROTQ9BRG1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VPS25 (NM_032353) Human Recombinant Protein

View all Vps25 recombinant proteins

SKU/Catalog Number

PROTQ9BRG1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VPS25 (NM_032353) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRG1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.6 kDa

Amino Acid Sequence

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Validation Images & Assay Conditions

Gene/Protein Information For VPS25 (Source: Uniprot.org, NCBI)

Gene Name

VPS25

Full Name

Vacuolar protein-sorting-associated protein 25

Weight

20.6 kDa

Superfamily

VPS25 family

Alternative Names

Dermal papilla-derived protein 9; DERP9; DERP9hVps25; EAP20; EAP20FAP20; ELL-associated protein of 20 kDa; ESCRT-II complex subunit VPS25; FAP20; MGC10540; vacuolar protein sorting 25 (yeast); vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein-sorting-associated protein 25

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VPS25, check out the VPS25 Infographic

VPS25 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VPS25: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRG1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VPS25 (NM_032353) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VPS25 (NM_032353) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VPS25 (NM_032353) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRG1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product