VPS36 (NM_016075) Human Recombinant Protein

VPS36 protein,

Recombinant protein of human vacuolar protein sorting 36 homolog (S. cerevisiae) (VPS36)

Product Info Summary

SKU: PROTQ86VN1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

VPS36 (NM_016075) Human Recombinant Protein

View all VPS36 recombinant proteins

SKU/Catalog Number

PROTQ86VN1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human vacuolar protein sorting 36 homolog (S. cerevisiae) (VPS36)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

VPS36 (NM_016075) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86VN1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.6 kDa

Amino Acid Sequence

MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS

Validation Images & Assay Conditions

Gene/Protein Information For VPS36 (Source: Uniprot.org, NCBI)

Gene Name

VPS36

Full Name

Vacuolar protein-sorting-associated protein 36

Weight

43.6 kDa

Superfamily

VPS36 family

Alternative Names

C13orf9; CGI-145; DKFZp781E0871; Eap45; EAP45chromosome 13 open reading frame 9; ELL-associated protein of 45 kDa; ELL-associated protein, 45 kDa; ESCRT-II complex subunit VPS36; vacuolar protein sorting 36 homolog (S. cerevisiae); vacuolar protein sorting 36 homolog (yeast); vacuolar protein-sorting-associated protein 36 VPS36 C13orf9, CGI-145, EAP45 vacuolar protein sorting 36 homolog vacuolar protein-sorting-associated protein 36|ELL-associated protein of 45 kDa|ESCRT-II complex subunit VPS36

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on VPS36, check out the VPS36 Infographic

VPS36 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for VPS36: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86VN1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used VPS36 (NM_016075) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For VPS36 (NM_016075) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for VPS36 (NM_016075) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86VN1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.